SecReT6
Protein ID: 253689617
SecReT6 ID353
T6SS typei1
Gene symbol-
Locus tagPC1_3251
StrainPectobacterium carotovorum subsp. carotovorum PC1
Repliconchromosome [GenBank: NC_012917] [Browse all T6SS(s) in this replicon]
Location [Strand]3667061..3668059 [-]
Producttype VI secretion protein
NoteTssG
UniProt IDC6DCU6
KEGG IDpct:PC1_3251
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.30E-95, Aligned region: 16..319
Protein Sequence: 332 a.a.     [Download]
>gi|253689617|ref|YP_003018807.1| type VI secretion protein [Pectobacterium carotovorum subsp. carotovorum PC1]
MAGTDRSTLNDVTFRQDVSRFNFFQLVELLNQLEGVDLEQELDFRPEQERLRFRSTASIGFHPGDILQVE
CDDEGRQELEVAFLGLHGSQSPMPGYYLEELAWEYAQGEQKLGVFLDFFHHRLLTLLHRAWRKYRYHVRF
QNDGEDGFSRLMFALVGLGNDAVRDSLPVNRAKMLSYAGVLASPSRSPEVVAGLVIHCFDLDDVAVMAWQ
HRRVPIHEGQQNRLGKANMMLGGDFVIGDKVSDCAGKFLLKVGNLSFSRFLSFLPNGEHFQPLVRFVSFI
LRDQLAWDLRLGFAEGEAKGLSLGSEQSSRLGWSSFLGQPPADPYVTICVQE
 
Nucleotide Sequence: 999 bp     [Download]
>gi|253686409|ref|NC_012917.1|:c3668059-3667061 Pectobacterium carotovorum subsp. carotovorum PC1, complete genome
ATGGCCGGTACAGATAGGTCAACACTCAATGATGTGACGTTCCGTCAGGATGTCTCACGCTTTAATTTTT
TCCAACTGGTGGAGTTGCTTAACCAACTGGAAGGCGTGGATCTGGAACAAGAGCTGGATTTCCGCCCGGA
GCAGGAGCGCCTGCGCTTTCGCTCTACCGCCTCCATTGGTTTTCACCCCGGCGATATCTTGCAGGTGGAA
TGCGATGACGAGGGGCGTCAGGAACTGGAGGTCGCGTTTCTTGGCCTGCATGGTAGCCAGTCACCGATGC
CCGGTTATTACCTTGAAGAGCTAGCCTGGGAATACGCACAGGGCGAACAGAAACTGGGCGTGTTTCTCGA
CTTCTTTCATCACCGCTTACTTACGCTTTTGCACCGCGCATGGCGCAAATACCGCTATCACGTGCGTTTT
CAGAATGATGGGGAGGATGGATTCTCCCGCCTGATGTTTGCGCTCGTGGGGTTAGGGAATGACGCCGTAC
GCGATAGCTTGCCAGTTAACCGCGCCAAGATGCTGTCCTACGCCGGGGTGCTCGCAAGCCCTAGTCGCTC
GCCAGAAGTGGTCGCGGGATTGGTTATTCACTGTTTTGACCTGGATGACGTAGCCGTTATGGCCTGGCAG
CACCGCCGCGTCCCCATTCATGAAGGCCAGCAGAACCGTCTGGGCAAAGCCAACATGATGCTGGGCGGTG
ACTTTGTTATCGGCGACAAAGTGAGTGACTGTGCCGGCAAGTTTTTACTCAAGGTCGGCAACCTCAGTTT
TAGCCGCTTCCTCAGCTTTTTGCCCAACGGCGAGCATTTTCAGCCGCTGGTGCGTTTTGTTTCTTTCATT
CTTCGCGATCAGCTGGCCTGGGATCTGCGTCTTGGCTTTGCGGAAGGCGAAGCCAAGGGCTTAAGCCTGG
GCAGTGAACAAAGTAGCCGATTGGGATGGAGCAGCTTTCTCGGGCAGCCGCCCGCGGATCCCTATGTGAC
GATTTGTGTGCAGGAGTAA