SecReT6
Protein ID: 253689618
SecReT6 ID353
T6SS typei1
Gene symbol-
Locus tagPC1_3252
StrainPectobacterium carotovorum subsp. carotovorum PC1
Repliconchromosome [GenBank: NC_012917] [Browse all T6SS(s) in this replicon]
Location [Strand]3668023..3669789 [-]
Producttype VI secretion protein
NoteTssF
UniProt IDC6DCU7
KEGG IDpct:PC1_3252
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.70E-199, Aligned region: 3..587
Protein Sequence: 588 a.a.     [Download]
>gi|253689618|ref|YP_003018808.1| type VI secretion protein [Pectobacterium carotovorum subsp. carotovorum PC1]
MSLEHFFRDELTYLRLQGREFAKAHPELTRFLSEQTTDPDVERLLEGFAFLTGSLRAKIEDEFPELTHGL
LGMLWPNYLRPVPSMTIMQFSVLPGAIAQPAFVARGCELDSLPIDDVICHFQTCHDAWIYPADIREIKVQ
SGNDLSTITLDIGLHGPLSLSDLQLDKLRFYLGGDTYTAYELYFWIASQLSHIELEIDGQRFRQEASVLK
TVGFEREDALLPYPGNVYSGYRILQEYFCFPESFLFFQLAGAVWPDLPLTVTEFRLHFCFDRPLPAELKI
RPDSFMLNCVPAINLFQHDSEPINLSGRQTDYPLKASYRNADSFEIFSVDKVEGWVEGNSGRARGIPRTY
QPFESFQHQIERAKGRLALYYRIRVREAVNGNGFDHMLSFVRGDEQEVIDLDESISVTLTCTNRSRAAQL
PVGAICVPTGNSPSFATFRNLVRPTRPLRPAMDGSLHWTLISNLSLNYVSLLRRDALVQILRTYDFPALH
DKQAEQASRKRLAGIESIETTPIDRLVQGMPVRGLKSILSVRQSAFSSEGELYLFSTVLAHFFSLYASVN
AFHLLEVVNIDNKERYRWPVQIGQHSMM
 
Nucleotide Sequence: 1767 bp     [Download]
>gi|253686409|ref|NC_012917.1|:c3669789-3668023 Pectobacterium carotovorum subsp. carotovorum PC1, complete genome
ATGTCACTGGAACATTTTTTCAGGGATGAGCTGACCTACTTGCGCCTGCAAGGGCGTGAATTCGCCAAGG
CGCACCCTGAGCTTACCCGATTTTTGTCAGAACAGACCACGGATCCAGACGTCGAGCGTCTGCTGGAAGG
GTTCGCCTTTTTGACAGGGAGCCTGCGGGCGAAGATCGAGGACGAATTTCCGGAGCTGACACACGGTCTG
CTGGGCATGCTGTGGCCTAATTACCTGCGCCCGGTACCGAGCATGACGATTATGCAGTTTTCGGTACTCC
CCGGCGCAATTGCCCAACCGGCGTTTGTTGCGCGCGGCTGTGAGCTTGATAGCCTGCCGATTGATGATGT
GATCTGTCATTTTCAGACCTGTCACGATGCCTGGATTTATCCGGCGGATATCCGCGAGATCAAGGTACAG
AGCGGCAACGATCTTTCCACCATCACGCTGGATATTGGGTTGCATGGCCCGCTATCGCTCAGCGATTTGC
AACTCGACAAGCTGCGCTTTTATCTGGGTGGTGATACCTATACGGCCTACGAACTCTATTTCTGGATTGC
CAGCCAGCTGTCACATATTGAGCTGGAAATTGATGGTCAACGCTTCCGTCAGGAAGCCAGCGTACTGAAG
ACGGTCGGATTTGAACGCGAAGATGCGCTATTGCCGTACCCCGGCAACGTTTACTCGGGCTATCGCATTT
TGCAGGAATACTTCTGTTTTCCTGAAAGCTTCCTCTTTTTCCAACTCGCGGGCGCGGTATGGCCGGATCT
CCCGCTGACGGTAACGGAATTCCGTCTGCACTTTTGCTTCGATCGCCCGCTGCCAGCGGAACTGAAGATT
CGTCCTGATTCATTCATGCTCAACTGTGTGCCGGCGATCAATCTCTTCCAGCATGATAGCGAGCCGATCA
ACCTCAGCGGTCGCCAGACGGATTATCCGCTGAAGGCCAGCTATCGTAACGCTGATAGCTTTGAAATCTT
CTCTGTGGATAAGGTGGAAGGCTGGGTTGAAGGGAATTCCGGGCGTGCTCGCGGCATTCCACGAACCTAT
CAGCCTTTTGAGAGCTTTCAGCACCAAATCGAGCGCGCTAAAGGACGGCTGGCGCTTTATTACCGCATTC
GGGTAAGAGAGGCGGTGAACGGCAACGGCTTTGATCACATGCTCTCTTTTGTCCGTGGCGATGAGCAGGA
AGTGATTGATTTGGATGAATCCATTTCGGTTACCCTGACCTGCACCAATCGCTCGCGTGCGGCACAGTTA
CCTGTCGGGGCGATCTGCGTGCCGACCGGGAACTCGCCGTCTTTCGCGACATTTCGCAATCTGGTGCGGC
CGACGCGACCGCTGCGGCCTGCGATGGACGGTAGCCTGCACTGGACGCTGATCTCCAACCTGTCTCTGAA
CTATGTGTCGCTGCTGCGGCGCGATGCACTGGTACAGATTCTGCGTACCTATGATTTCCCGGCGCTGCAC
GACAAGCAGGCCGAACAGGCTTCGCGTAAGCGTCTGGCGGGTATCGAATCTATCGAAACCACCCCTATCG
ATCGTCTGGTTCAGGGGATGCCGGTTCGCGGCTTGAAATCCATTCTGTCAGTACGGCAATCCGCGTTTTC
CAGTGAAGGAGAACTCTATCTGTTCAGTACGGTGCTGGCGCACTTCTTCTCGCTATACGCCAGCGTCAAC
GCTTTCCACCTGTTGGAAGTGGTCAACATCGATAACAAGGAGCGCTACCGATGGCCGGTACAGATAGGTC
AACACTCAATGATGTGA