SecReT6
Protein ID: 253689619
SecReT6 ID353
T6SS typei1
Gene symbol-
Locus tagPC1_3253
StrainPectobacterium carotovorum subsp. carotovorum PC1
Repliconchromosome [GenBank: NC_012917] [Browse all T6SS(s) in this replicon]
Location [Strand]3669792..3670223 [-]
Producttype VI secretion system lysozyme-like protein
NoteTssE
UniProt IDC6DCU8
KEGG IDpct:PC1_3253
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 2.70E-20, Aligned region: 32..123
Protein Sequence: 143 a.a.     [Download]
>gi|253689619|ref|YP_003018809.1| type VI secretion system lysozyme-like protein [Pectobacterium carotovorum subsp. carotovorum PC1]
MPSLSAWERGNAASLFDRIRGEERRSSPETEVEALIESVKRQLDNVLNTRPGNCRSAPELGVIDFNDATQ
GGADIRGKIREAIRQCICRFEPRIVHVDVDASDYLSNPMEMSFQVTAHVRLEDLEQVTSFNIHMDSHRHY
RMI
 
Nucleotide Sequence: 432 bp     [Download]
>gi|253686409|ref|NC_012917.1|:c3670223-3669792 Pectobacterium carotovorum subsp. carotovorum PC1, complete genome
ATGCCGTCTCTTTCTGCCTGGGAAAGGGGAAACGCGGCAAGTCTGTTTGATCGTATCCGTGGGGAGGAGC
GCCGCTCCTCCCCAGAAACGGAAGTTGAAGCACTGATCGAGTCCGTTAAGCGTCAACTGGACAATGTGCT
CAATACCCGGCCCGGAAATTGTCGCAGCGCACCTGAGCTTGGCGTGATTGATTTTAATGACGCGACGCAG
GGTGGGGCGGACATTCGAGGGAAAATCCGGGAGGCGATCCGGCAGTGTATCTGTCGCTTTGAACCTCGAA
TTGTTCATGTGGATGTCGACGCATCGGACTATTTATCGAATCCGATGGAGATGTCGTTTCAGGTTACCGC
GCATGTCAGATTGGAAGATCTGGAGCAGGTCACCTCTTTCAATATCCACATGGATAGCCACCGCCATTAC
AGAATGATCTGA