SecReT6
Protein ID: 253689620
SecReT6 ID353
T6SS typei1
Gene symbol-
Locus tagPC1_3254
StrainPectobacterium carotovorum subsp. carotovorum PC1
Repliconchromosome [GenBank: NC_012917] [Browse all T6SS(s) in this replicon]
Location [Strand]3670229..3671707 [-]
ProductEvpB family type VI secretion protein
NoteTssC
UniProt IDC6DCU9
KEGG IDpct:PC1_3254
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 9.10E-186, Aligned region: 65..490
Protein Sequence: 492 a.a.     [Download]
>gi|253689620|ref|YP_003018810.1| EvpB family type VI secretion protein [Pectobacterium carotovorum subsp. carotovorum PC1]
MSIVEEQAQAGAASASGSLLDDIMAQARITPVDEGYSVAKQGIAALVANILDSGNAAEPVNKALVDSMIV
ELDKKLSKQIDVILHAKELQELESSWRSLKLLVDRTDFRENIKLLVLHATKEELLEDFEFAPEISQSGFY
KHVYSSGYGQFGGQPIGGVIGDYAMTQSSPDIKLMQYVSAVGAMAHAPFISSVAPTFFGVDSFTDLPSIK
DLKSVFEGPAYTKWRSLRESEDGRYLGLTAPRFLARLPYDPVENPIKGFNYKEDISTDHEHYLWGNTAYL
MGTALTDSFAKYRWCPNIIGPQSGGAITDLPVHVYEAMGQLQAKIPTEVLITDRREYEMAEEGFITLTMR
KDSDNAAFFSANSVQKPKVFPNTKEGKEAETNYKLGTQLPYMFIINRLAHYIKVLQREQIGSWKERQDLE
RELNTWIKQYIADQENPPADVRSRRPLRAAQIKVLDVEGEPGWYQVTMSVRPHFKYMGANFELSLVGRLD
KE
 
Nucleotide Sequence: 1479 bp     [Download]
>gi|253686409|ref|NC_012917.1|:c3671707-3670229 Pectobacterium carotovorum subsp. carotovorum PC1, complete genome
ATGTCAATAGTTGAAGAACAGGCCCAGGCAGGGGCTGCCAGCGCCTCCGGATCGCTGCTTGATGACATCA
TGGCTCAAGCGCGTATCACCCCGGTCGATGAAGGCTACAGCGTTGCTAAACAGGGGATTGCCGCACTGGT
CGCTAACATTCTTGATAGCGGTAATGCAGCAGAACCCGTGAATAAAGCGCTGGTCGATAGCATGATTGTC
GAACTGGACAAAAAGCTCAGTAAGCAGATCGACGTTATTCTGCATGCTAAAGAACTTCAGGAGCTGGAAT
CTTCCTGGCGTTCGCTGAAACTGCTTGTCGATCGCACTGATTTCCGTGAAAACATCAAACTGTTGGTGTT
ACATGCGACGAAAGAAGAGCTGTTAGAGGATTTTGAGTTCGCGCCTGAAATCTCACAGTCTGGCTTCTAT
AAACATGTGTACTCCAGCGGTTACGGCCAGTTCGGCGGCCAGCCTATTGGTGGCGTGATCGGTGACTATG
CGATGACGCAAAGCTCACCAGACATCAAACTGATGCAGTACGTCAGCGCCGTTGGCGCGATGGCGCACGC
ACCATTCATCTCTTCCGTTGCGCCGACCTTCTTTGGCGTGGATAGCTTCACCGATTTACCGTCCATCAAA
GATCTGAAATCCGTTTTCGAAGGCCCTGCCTACACGAAATGGCGTTCGCTGCGTGAGTCTGAAGACGGTC
GCTATCTGGGGCTGACGGCACCGCGCTTCCTGGCTCGCTTGCCTTACGACCCGGTAGAAAACCCGATTAA
GGGCTTTAACTACAAAGAAGATATCAGCACCGATCACGAACACTATCTGTGGGGCAATACCGCCTACCTG
ATGGGAACGGCGCTGACGGACAGCTTCGCGAAATACCGCTGGTGTCCGAACATCATTGGCCCGCAGAGCG
GCGGTGCGATTACCGACCTGCCAGTGCATGTTTATGAAGCTATGGGTCAACTTCAGGCCAAGATCCCGAC
TGAAGTCCTGATCACCGATCGTCGCGAATATGAAATGGCCGAAGAGGGCTTTATCACGCTGACGATGCGT
AAAGACAGCGACAACGCGGCTTTCTTCTCGGCTAACTCGGTGCAGAAGCCGAAGGTGTTCCCGAACACCA
AAGAAGGCAAAGAAGCGGAAACCAACTACAAGCTGGGTACGCAGCTGCCGTACATGTTCATCATCAACCG
TCTGGCGCACTACATCAAAGTGCTACAGCGTGAACAGATTGGCTCATGGAAAGAGCGTCAGGATCTGGAA
CGTGAGCTGAATACCTGGATTAAACAGTACATCGCCGATCAGGAAAACCCGCCGGCAGATGTCCGTAGCC
GTCGTCCTCTGCGTGCTGCACAAATCAAAGTGCTGGATGTGGAAGGAGAACCAGGTTGGTATCAGGTCAC
CATGTCTGTGCGCCCGCACTTCAAGTACATGGGGGCAAACTTTGAGCTGTCGCTGGTAGGGCGTTTGGAT
AAGGAATAA