SecReT6
Protein ID: 253689621
SecReT6 ID353
T6SS typei1
Gene symbol-
Locus tagPC1_3255
StrainPectobacterium carotovorum subsp. carotovorum PC1
Repliconchromosome [GenBank: NC_012917] [Browse all T6SS(s) in this replicon]
Location [Strand]3671740..3672243 [-]
Producttype VI secretion protein
NoteTssB
UniProt IDC6DCV0
KEGG IDpct:PC1_3255
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.60E-56, Aligned region: 9..161
Protein Sequence: 167 a.a.     [Download]
>gi|253689621|ref|YP_003018811.1| type VI secretion protein [Pectobacterium carotovorum subsp. carotovorum PC1]
MAKGTDGASVAPKERINIKYVPATGGQQAEIELPLTLMIVGNMKGRTEETPIEERQTVSIDKNNFTSVMK
EAELELNFSVPNRLEEESQDDLPVKLSIGGLNDFSPDRIAQQVPELRKLLDLREALVALKGPLGNIPSFR
NRLQDLLSSEEAREQLLKELDLVKPAE
 
Nucleotide Sequence: 504 bp     [Download]
>gi|253686409|ref|NC_012917.1|:c3672243-3671740 Pectobacterium carotovorum subsp. carotovorum PC1, complete genome
ATGGCAAAAGGAACTGACGGTGCATCTGTCGCACCAAAGGAACGTATTAATATCAAATATGTTCCAGCCA
CTGGTGGTCAGCAGGCGGAAATAGAATTGCCGTTGACGCTGATGATCGTGGGAAATATGAAAGGGCGCAC
AGAGGAAACGCCGATCGAAGAACGTCAGACCGTCTCGATCGACAAGAACAACTTTACCTCGGTGATGAAA
GAAGCAGAGCTGGAACTGAATTTCAGTGTGCCAAACCGCCTTGAAGAAGAAAGCCAGGATGACCTGCCAG
TGAAACTGAGCATCGGCGGTCTGAATGATTTCTCCCCTGACCGTATCGCCCAACAGGTGCCTGAGTTGCG
TAAGTTGCTTGATTTACGTGAGGCGCTGGTTGCGCTGAAAGGCCCCCTCGGCAATATTCCCTCATTCCGT
AATCGTTTGCAGGATCTGTTGTCCAGCGAAGAAGCCAGAGAGCAGCTTTTGAAAGAGCTCGATCTGGTAA
AACCCGCCGAATAA