SecReT6
Protein ID: 253699832
SecReT6 ID354
T6SS typei4a
Gene symbol-
Locus tagGM21_1202
StrainGeobacter sp. M21
Repliconchromosome [GenBank: NC_012918] [Browse all T6SS(s) in this replicon]
Location [Strand]1407063..1407551 [+]
Producttype VI secretion lipoprotein
NoteTssJ
UniProt IDC6E3J8
KEGG IDgem:GM21_1202
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 8.50E-23, Aligned region: 12..156
Protein Sequence: 162 a.a.     [Download]
>gi|253699832|ref|YP_003021021.1| type VI secretion lipoprotein [Geobacter sp. M21]
MKRMLVAVMLALIGVGCSTGGGTTGARGNDSKDLVRVEIAADPQLNRYEKNSHALVLCLYQLNDVESFTR
LAQGNEGMPKLLECGRFDGTVVSVGQMVVQPGQELTEIRERGNGARYLGIATGYYSTGRKKMTALATIPE
DRRESVLRIELGAQEIRQVRVE
 
Nucleotide Sequence: 489 bp     [Download]
>gi|253698656|ref|NC_012918.1|:1407063-1407551 Geobacter sp. M21 chromosome, complete genome
ATGAAAAGAATGCTTGTTGCGGTGATGCTGGCTTTAATTGGTGTCGGTTGCTCGACCGGCGGCGGAACGA
CCGGCGCGCGTGGAAATGATTCGAAGGACCTGGTCCGTGTCGAAATAGCGGCGGACCCCCAACTGAACCG
CTATGAGAAGAACTCACATGCGCTCGTGCTTTGCCTTTATCAGCTAAACGATGTCGAGAGCTTCACCCGC
CTGGCCCAAGGAAACGAGGGGATGCCGAAACTTCTTGAATGCGGCAGGTTCGACGGGACGGTGGTCAGCG
TAGGGCAGATGGTGGTGCAGCCGGGGCAGGAACTGACGGAGATTCGCGAGAGGGGAAACGGCGCCCGGTA
CCTCGGAATAGCTACCGGCTACTACAGCACAGGCAGAAAGAAGATGACCGCTCTCGCGACGATTCCGGAG
GACCGGAGGGAGAGCGTGCTGCGTATCGAACTGGGGGCACAGGAAATACGACAGGTGAGGGTGGAATGA