SecReT6
Protein ID: 253699833
SecReT6 ID354
T6SS typei4a
Gene symbol-
Locus tagGM21_1203
StrainGeobacter sp. M21
Repliconchromosome [GenBank: NC_012918] [Browse all T6SS(s) in this replicon]
Location [Strand]1407548..1408942 [+]
Producttype VI secretion protein
NoteTssK
UniProt IDC6E3J9
KEGG IDgem:GM21_1203
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.10E-82, Aligned region: 20..461
Protein Sequence: 464 a.a.     [Download]
>gi|253699833|ref|YP_003021022.1| type VI secretion protein [Geobacter sp. M21]
MMSIERQVFWHQGLFLQPQHFQLSERSLQSQLAPYQLCLMPDFWGVQRMEIRCTAGGIPSLEISGAFLFP
DGTYAVVAENARAESRPVLEEAVAGRDSCTVYLGLKKWSPAGHNVTTLLPGAPLSKVATRFVAESDAAPR
ADLHAGGAEAEVRQMALTLQLFWESELESLGDYLLIPVARLALRGETAVLSRDFIPPCITLSGSSALFDL
LQEIREQLASRCRWLEGYKKERGIQAAEFGSKDLVFLLALRTVSRHLARLSHWIEAGEVHPWQVYGLLGE
LAAELTCFSETTGAFGESVADGPRLMPQYRHKDLGCCFRLARDLIVQLLNEVTAGPEYALTLAFDGTWFA
SDLKPAHFQGHSRFYLVLNTNEDPKLVLASVATAAKLTARERLPLLISQALPGIALEHVSDPPRELPHRS
TSLFFSIDSRCDQWELVRKWNNIALSWDQAPADLEVQLMIVARS
 
Nucleotide Sequence: 1395 bp     [Download]
>gi|253698656|ref|NC_012918.1|:1407548-1408942 Geobacter sp. M21 chromosome, complete genome
ATGATGTCCATCGAGAGGCAGGTATTCTGGCACCAGGGGCTGTTTCTGCAGCCCCAGCATTTCCAGCTCT
CAGAGCGCTCGTTGCAGTCGCAACTGGCTCCGTACCAGTTGTGTCTCATGCCTGACTTTTGGGGCGTGCA
ACGGATGGAGATCAGGTGCACAGCCGGCGGGATACCTAGCCTCGAAATTTCCGGCGCCTTCCTTTTTCCC
GACGGCACCTATGCCGTCGTCGCTGAGAACGCGCGGGCCGAGTCCAGGCCGGTCCTCGAAGAGGCAGTGG
CGGGAAGGGATTCCTGTACCGTCTACCTTGGCTTGAAGAAATGGAGCCCCGCCGGCCATAACGTCACCAC
CTTGCTCCCTGGCGCCCCCCTCTCCAAGGTCGCTACGCGCTTCGTTGCCGAGTCCGACGCCGCGCCCCGT
GCCGATCTCCACGCAGGGGGGGCTGAGGCGGAGGTGCGGCAGATGGCTTTGACCCTGCAGCTTTTCTGGG
AGAGCGAGCTGGAGTCGTTGGGGGATTACCTGCTCATCCCTGTCGCCCGGCTCGCGCTGCGCGGCGAAAC
CGCGGTGCTCTCCCGTGACTTTATCCCCCCCTGCATCACCCTGTCCGGCTCATCCGCGCTCTTCGACCTG
CTCCAGGAAATCCGGGAACAGCTGGCCTCCCGCTGCCGCTGGCTGGAGGGTTACAAGAAGGAACGGGGCA
TTCAGGCCGCTGAGTTCGGTTCCAAAGATCTGGTTTTCCTCCTGGCCCTCAGAACCGTGAGCCGGCACCT
AGCGAGGCTTAGCCACTGGATCGAGGCGGGTGAGGTTCACCCTTGGCAGGTTTACGGGCTTCTGGGAGAG
CTCGCCGCGGAACTGACCTGCTTCTCGGAGACCACCGGCGCCTTCGGTGAGTCCGTGGCCGACGGGCCAA
GGCTCATGCCGCAGTACCGGCACAAAGATCTGGGGTGCTGCTTCCGGCTGGCCCGCGATCTCATCGTCCA
GCTGCTGAACGAGGTGACCGCGGGGCCGGAATACGCACTGACCCTCGCCTTCGACGGGACCTGGTTCGCC
TCCGATCTCAAGCCCGCGCACTTCCAGGGGCACAGCAGGTTTTACCTGGTGCTGAATACGAACGAGGATC
CGAAACTCGTCCTTGCTTCGGTCGCGACCGCAGCGAAGCTGACCGCGCGCGAACGGTTGCCGCTGTTGAT
CTCCCAGGCGCTCCCGGGGATCGCCCTGGAGCATGTCTCCGATCCCCCCCGCGAACTGCCGCATCGCTCC
ACCTCCCTCTTTTTCAGCATAGACAGCCGCTGCGATCAGTGGGAGCTGGTGCGGAAGTGGAATAATATCG
CGCTCAGCTGGGACCAGGCCCCAGCCGACCTCGAAGTGCAGCTCATGATCGTTGCCAGGTCCTAG