SecReT6
Protein ID: 253699834
SecReT6 ID354
T6SS typei4a
Gene symbol-
Locus tagGM21_1204
StrainGeobacter sp. M21
Repliconchromosome [GenBank: NC_012918] [Browse all T6SS(s) in this replicon]
Location [Strand]1408963..1409622 [+]
ProductDotU family type IV / VI secretion system protein
NoteTssL
UniProt IDC6E3K0
KEGG IDgem:GM21_1204
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.80E-43, Aligned region: 2..211
Protein Sequence: 219 a.a.     [Download]
>gi|253699834|ref|YP_003021023.1| DotU family type IV / VI secretion system protein [Geobacter sp. M21]
MRLIDSFMPLIAYVVDFRAACRDTPRGYQEVKGDIAQLLLQAEKACGKEAVVSDEYDLARFAVCSWVDET
LLGSDWRDRQLWQREQLQRLYYRTTEAGVELFDRLQALGARGEVREVYYLCLALGFKGRYIGPGDEAKLE
HLKQENLKLLLGTPAGIPSLEQGELFPGAHAPGRESSALKAPSGISPLTAMLIAAPIFLFVVLFLIYRYL
LNGLVLPVL
 
Nucleotide Sequence: 660 bp     [Download]
>gi|253698656|ref|NC_012918.1|:1408963-1409622 Geobacter sp. M21 chromosome, complete genome
ATGCGATTGATCGACTCTTTCATGCCGCTCATAGCCTACGTGGTCGACTTCCGCGCCGCTTGCCGCGACA
CGCCCCGCGGTTATCAGGAGGTGAAGGGGGATATCGCGCAGTTGCTGCTGCAGGCGGAAAAGGCATGCGG
CAAGGAAGCGGTGGTGAGCGACGAGTACGATCTCGCCCGCTTCGCGGTCTGCTCCTGGGTCGACGAGACG
CTCCTGGGTTCCGACTGGAGGGACAGGCAGCTCTGGCAGCGGGAGCAACTGCAGCGGCTTTATTACCGCA
CCACAGAGGCGGGGGTGGAGCTTTTCGACCGGCTGCAGGCGCTGGGGGCGCGGGGCGAGGTGCGGGAGGT
CTATTACCTCTGCCTCGCCCTTGGTTTCAAGGGGCGTTATATCGGGCCGGGAGACGAGGCCAAGCTGGAA
CATCTGAAACAAGAGAACCTGAAGTTGCTGCTCGGGACCCCGGCCGGCATCCCGTCGCTGGAGCAGGGGG
AGCTCTTCCCGGGTGCCCATGCCCCCGGCCGCGAAAGTTCGGCCCTGAAGGCTCCCTCTGGAATTTCCCC
GCTGACCGCGATGCTGATCGCAGCACCCATCTTCCTGTTCGTGGTGCTGTTTCTCATTTACCGCTACCTG
CTAAACGGCCTGGTGCTTCCGGTCCTCTAG