SecReT6
Protein ID: 253699836
SecReT6 ID354
T6SS typei4a
Gene symbol-
Locus tagGM21_1206
StrainGeobacter sp. M21
Repliconchromosome [GenBank: NC_012918] [Browse all T6SS(s) in this replicon]
Location [Strand]1413053..1414372 [+]
Producttype VI secretion-associated protein, ImpA family
NoteTssA
UniProt IDC6E3K2
KEGG IDgem:GM21_1206
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 3.50E-22, Aligned region: 55..114
ImpA-rel_N [PF06812], Evalue: 3.50E-22, Aligned region: 215..235
TPR_4 [PF07721], Evalue: 0.0012, Aligned region: 317..337
TPR_4 [PF07721], Evalue: 0.0012, Aligned region: 354..376
Protein Sequence: 439 a.a.     [Download]
>gi|253699836|ref|YP_003021025.1| type VI secretion-associated protein, ImpA family [Geobacter sp. M21]
MQEIAVDELLAPISKEAPAGSDLRYTTIYEEIMEARRSDDAVALGDWRHDVKAADWNKVIKLCVAALSTK
SKDLQIAVWLCESLIVVDGFPGFDAGLRLMKELMEQYWDCFYPLSGDDDLEYRAAPLDFLNEKVATHVKK
IPLTDPEVTPGYSWLKWNQSRGVGYEVDTRNSYGEVEEEWKQRRDLRISEGALTAEEFDAAVDKSRGPFS
ERLLEDLKRCAESLQALEWEIEAKWLPTSAPSLASLGAAMNSCLMLAGKCYGVASPAQASQAEAKEGEVQ
GTGEKETEEAPPPALRQPEGIAGFPGPGAPQEKESSLWGEGLALLEAGHLEQALTMLLYTSHSCESTRDR
NRIRLLMVKLCLRAGRADLARPIVEELHDMIEELKLERWESPVWIAEVLHAYYQCLQAGELPDEDLTLSR
VLFKRICSLDVTKGIPYRI
 
Nucleotide Sequence: 1320 bp     [Download]
>gi|253698656|ref|NC_012918.1|:1413053-1414372 Geobacter sp. M21 chromosome, complete genome
ATGCAAGAGATAGCAGTGGACGAACTGCTGGCCCCAATCAGCAAGGAAGCGCCTGCGGGAAGCGATCTGC
GCTACACCACCATCTACGAGGAGATAATGGAGGCCCGCAGAAGCGATGATGCCGTAGCCCTCGGGGACTG
GCGCCATGATGTAAAGGCTGCCGACTGGAACAAGGTGATCAAGCTCTGCGTCGCCGCCCTTTCCACCAAG
AGCAAAGACCTGCAGATAGCGGTCTGGCTTTGCGAGTCGCTTATCGTGGTCGACGGTTTTCCCGGTTTCG
ACGCAGGTCTGCGCCTGATGAAGGAACTCATGGAACAGTACTGGGATTGCTTCTACCCGTTAAGCGGCGA
CGACGACCTGGAATACCGGGCCGCCCCGTTGGACTTTCTGAACGAGAAGGTCGCCACGCACGTGAAGAAG
ATCCCTCTCACCGACCCCGAGGTGACGCCGGGGTACTCCTGGCTTAAATGGAACCAGTCCCGCGGTGTCG
GTTATGAGGTTGACACCAGGAACAGTTACGGAGAGGTGGAGGAGGAATGGAAACAACGCCGGGATCTGCG
CATTTCCGAGGGGGCCCTCACCGCGGAGGAATTCGATGCCGCAGTCGATAAATCCCGCGGCCCCTTTTCC
GAGCGGCTTCTGGAAGACCTTAAGCGCTGTGCCGAGAGTCTGCAGGCGTTGGAATGGGAGATCGAGGCGA
AGTGGTTGCCCACGTCGGCGCCGAGCCTGGCCTCCTTGGGGGCGGCCATGAACAGCTGCCTTATGCTGGC
AGGTAAGTGCTATGGCGTCGCATCTCCCGCCCAGGCAAGTCAGGCCGAAGCAAAAGAGGGCGAAGTACAG
GGGACGGGAGAGAAGGAAACGGAAGAGGCGCCGCCGCCGGCGCTCCGGCAGCCAGAAGGCATCGCCGGGT
TTCCCGGTCCCGGCGCTCCACAGGAGAAGGAGAGTTCGCTTTGGGGTGAGGGGCTCGCCCTGCTGGAGGC
GGGACATCTCGAACAGGCGCTGACCATGCTGCTTTACACCAGCCACAGCTGTGAATCCACCAGGGACCGC
AACCGGATCCGCCTCCTGATGGTGAAGCTTTGTCTCAGAGCGGGAAGGGCGGACCTGGCCAGGCCGATAG
TGGAGGAGTTGCACGACATGATCGAGGAGTTGAAGCTGGAGCGCTGGGAGTCGCCGGTGTGGATCGCGGA
GGTGCTGCACGCCTACTACCAGTGCCTTCAGGCGGGCGAGCTTCCCGATGAAGACCTCACCTTGTCGAGG
GTCCTGTTCAAACGGATCTGCTCCCTCGACGTCACCAAGGGGATCCCTTACCGGATCTGA