SecReT6
Protein ID: 253699837
SecReT6 ID354
T6SS typei4a
Gene symbol-
Locus tagGM21_1207
StrainGeobacter sp. M21
Repliconchromosome [GenBank: NC_012918] [Browse all T6SS(s) in this replicon]
Location [Strand]1414396..1414926 [+]
Producttype VI secretion protein
NoteTssB
UniProt IDC6E3K3
KEGG IDgem:GM21_1207
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 4.70E-55, Aligned region: 11..166
Protein Sequence: 176 a.a.     [Download]
>gi|253699837|ref|YP_003021026.1| type VI secretion protein [Geobacter sp. M21]
MAKSESLQHKLERVRAPRVRITYDVETGGGIEMKEIPFVVGVLADLSGKPDQPLPRLKERSFVEVDRDNI
DSVLEGMRPRAAFRVPNRLVEDGSQLAVDLRFTSLDDFHPEKVALQVEPLRRLVEARKRLSDLLARLDGN
DRLEQLLRGALSSPDALKLICEEAKSAKAPDTESAG
 
Nucleotide Sequence: 531 bp     [Download]
>gi|253698656|ref|NC_012918.1|:1414396-1414926 Geobacter sp. M21 chromosome, complete genome
ATGGCAAAGTCCGAGAGCCTGCAACACAAGTTGGAACGCGTGCGGGCGCCCCGTGTCCGCATCACCTACG
ACGTGGAGACCGGGGGCGGCATCGAGATGAAGGAGATCCCTTTCGTGGTGGGGGTGCTCGCCGACCTGTC
GGGGAAGCCGGATCAACCCCTGCCGAGGCTGAAGGAGAGGAGCTTCGTGGAAGTGGACCGCGACAACATT
GATTCGGTCTTGGAGGGAATGCGGCCGAGAGCTGCGTTCCGGGTCCCGAACCGGCTGGTGGAAGACGGCT
CCCAACTCGCCGTCGACCTCCGTTTCACAAGTCTCGATGACTTTCATCCGGAGAAGGTGGCCCTGCAGGT
GGAGCCGCTTCGGAGACTGGTCGAGGCGCGGAAGAGGCTCTCGGATCTGCTCGCGAGGCTCGACGGCAAC
GACCGGCTCGAACAGCTGCTGCGGGGGGCGTTATCCAGTCCGGATGCGCTGAAACTCATCTGTGAGGAGG
CGAAGAGCGCCAAGGCACCCGACACTGAGAGCGCCGGATAA