SecReT6
Protein ID: 253699838
SecReT6 ID354
T6SS typei4a
Gene symbol-
Locus tagGM21_1208
StrainGeobacter sp. M21
Repliconchromosome [GenBank: NC_012918] [Browse all T6SS(s) in this replicon]
Location [Strand]1414938..1416425 [+]
Producttype VI secretion protein EvpB
NoteTssC
UniProt IDC6E3K4
KEGG IDgem:GM21_1208
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 8.30E-192, Aligned region: 67..490
Protein Sequence: 495 a.a.     [Download]
>gi|253699838|ref|YP_003021027.1| type VI secretion protein EvpB [Geobacter sp. M21]
MGEQDREPEVLYAEPLPAGGLLELIIQEGRLARGVCRHEHAVDLVGELAQQVLEGEMTVTRDTEQMINQR
IAQLDALISGQVNEIIHHPEFQRLEASWRGLDHLVHQSETGANLKIRVLNVSRRDLVQDMEKAAEFDQSA
LFKKVYEEEFGSYGGASYGCLVGDFDFGNTPQDLSLLTRMSEVAAAAHAPLLTAASPSLFNMETFAELDR
PRDLAKIFQGPEYAKWKSFRISEDARYVALCLPRVLMRLPYGPDADPAELFQFDEEVDGADHGKYLWGNA
AYCLAERVTEAFAKYGWTAAIRGVEGGGLVSELPVHSFKTGEGELAHKCPAEIAITDRREKELADLGFIP
LVHCKGTDNAAFFSAQSAHRPRSYDSDAANANARLSAQLQYILAVSRFAHYLKALMRDKVGSFDTRKNVE
DYLNRWISNYVLLDDDAGQEMKSRYPLREARVEVFEDPAKPGAYRAVAFLKPHFQLDELTVSLRLVASLP
APARE
 
Nucleotide Sequence: 1488 bp     [Download]
>gi|253698656|ref|NC_012918.1|:1414938-1416425 Geobacter sp. M21 chromosome, complete genome
ATGGGAGAGCAAGATAGAGAACCGGAAGTACTGTACGCTGAGCCGCTACCCGCGGGAGGCCTGCTGGAGC
TCATCATCCAGGAAGGGCGACTTGCCCGCGGCGTCTGTCGTCATGAGCATGCAGTGGACCTTGTGGGCGA
ACTGGCGCAACAGGTCCTTGAGGGCGAGATGACGGTGACCCGCGACACGGAACAGATGATCAACCAGAGG
ATCGCCCAACTGGACGCGCTCATCTCCGGGCAGGTGAACGAGATCATCCACCATCCCGAATTCCAGAGGT
TGGAAGCCTCCTGGCGCGGCCTTGACCATCTGGTGCACCAAAGCGAGACCGGAGCCAACCTGAAGATCAG
GGTCCTGAACGTTTCGCGCCGGGACCTCGTGCAGGACATGGAGAAGGCGGCAGAGTTCGATCAGTCCGCT
CTGTTCAAGAAGGTGTACGAGGAGGAGTTCGGCAGCTACGGGGGGGCTTCCTACGGTTGCCTGGTGGGTG
ACTTCGATTTCGGCAACACGCCGCAGGACCTTTCGCTGCTGACACGGATGTCCGAGGTCGCGGCTGCCGC
GCACGCACCGTTATTGACCGCTGCTTCTCCTTCCCTGTTCAACATGGAGACCTTCGCTGAACTCGACAGG
CCCAGGGACTTGGCCAAGATCTTCCAGGGGCCGGAATACGCCAAGTGGAAATCCTTCCGGATCTCCGAGG
ACGCCCGTTACGTTGCCCTTTGCCTACCCAGGGTGCTGATGCGGCTTCCCTACGGACCCGACGCCGATCC
GGCTGAACTATTCCAGTTCGATGAGGAGGTGGACGGCGCCGATCACGGCAAATATCTCTGGGGCAACGCC
GCCTACTGTCTGGCCGAACGGGTGACCGAAGCCTTCGCGAAATACGGCTGGACAGCGGCGATCAGGGGAG
TGGAGGGGGGCGGTCTTGTGAGCGAGCTGCCCGTGCACTCCTTCAAAACCGGGGAAGGGGAACTGGCCCA
CAAGTGCCCCGCTGAGATTGCCATTACCGACCGGCGCGAAAAGGAGTTGGCGGACCTGGGTTTCATTCCG
CTGGTCCATTGCAAAGGGACCGACAACGCCGCGTTCTTCAGCGCCCAAAGCGCGCACCGTCCCAGGAGCT
ACGACTCCGATGCGGCCAACGCCAACGCACGGCTCTCGGCGCAGTTGCAGTACATCCTCGCCGTCTCGCG
ATTCGCCCATTACCTGAAGGCGCTGATGCGCGACAAGGTCGGCAGCTTCGACACCAGGAAGAACGTGGAG
GACTACTTGAACCGCTGGATCAGCAACTACGTGCTTTTGGACGACGACGCCGGCCAGGAGATGAAATCGC
GGTACCCACTGCGGGAGGCCCGGGTGGAGGTTTTCGAAGATCCCGCCAAGCCAGGGGCCTACCGCGCCGT
CGCTTTTTTGAAGCCGCACTTCCAGCTTGACGAACTTACCGTCTCCCTGAGGCTTGTGGCCAGTCTGCCG
GCACCGGCAAGAGAATAA