SecReT6
Protein ID: 253699839
SecReT6 ID354
T6SS typei4a
Gene symbol-
Locus tagGM21_1209
StrainGeobacter sp. M21
Repliconchromosome [GenBank: NC_012918] [Browse all T6SS(s) in this replicon]
Location [Strand]1416439..1416936 [+]
Producttype VI secretion system effector
NoteTssD
UniProt IDC6E3K5
KEGG IDgem:GM21_1209
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 6.80E-43, Aligned region: 6..140
Protein Sequence: 165 a.a.     [Download]
>gi|253699839|ref|YP_003021028.1| type VI secretion system effector [Geobacter sp. M21]
MAFDAFLKIEGIPGESTDDKHKEWIEILSYNFSVMQRPSGSASTSGGASSERANFSDFNIVKALDKASPK
LFEACATGRHIPTVTLELCRAGGDKLKYMEYKLSNVIISMNRPGGTSHADDTLPLEEISFNYGKIELAYT
HQNRADGSGGGQIAAGWNLESNKKV
 
Nucleotide Sequence: 498 bp     [Download]
>gi|253698656|ref|NC_012918.1|:1416439-1416936 Geobacter sp. M21 chromosome, complete genome
ATGGCTTTTGACGCGTTTCTGAAAATAGAAGGGATACCGGGGGAGAGTACCGACGACAAGCACAAGGAAT
GGATCGAGATCCTCTCTTACAACTTCTCCGTAATGCAACGCCCCTCCGGTTCGGCGAGCACCTCCGGCGG
CGCCTCCTCCGAAAGGGCGAACTTCTCGGATTTCAACATCGTGAAGGCGCTGGACAAGGCGTCTCCGAAG
CTTTTCGAAGCCTGCGCCACCGGCCGGCACATCCCCACCGTCACGCTGGAACTGTGCCGGGCAGGGGGAG
ACAAGCTGAAGTACATGGAATACAAACTGAGCAACGTCATCATCAGCATGAACCGTCCCGGCGGCACCTC
GCACGCCGACGATACCCTCCCTCTTGAAGAGATCTCCTTCAACTACGGCAAGATCGAGCTCGCCTACACC
CATCAAAACCGCGCCGACGGTTCGGGCGGCGGCCAGATTGCCGCCGGCTGGAATCTAGAAAGCAACAAGA
AGGTTTGA