SecReT6
Protein ID: 253699840
SecReT6 ID354
T6SS typei4a
Gene symbol-
Locus tagGM21_1210
StrainGeobacter sp. M21
Repliconchromosome [GenBank: NC_012918] [Browse all T6SS(s) in this replicon]
Location [Strand]1416981..1417418 [+]
Producttype VI secretion system lysozyme-like protein
NoteTssE
UniProt IDC6E3K6
KEGG IDgem:GM21_1210
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.20E-17, Aligned region: 26..127
Protein Sequence: 145 a.a.     [Download]
>gi|253699840|ref|YP_003021029.1| type VI secretion system lysozyme-like protein [Geobacter sp. M21]
MLDRLIAAPARSGPGQGGEGVLGDILDSLLRDLENLLNTRRSVPLAPDCRQESQKSVLSYGGRDFSTHNP
RTALAREQIRLEIQRLLLSFEPRLKEAVVRLEAIPETGRTLQFRIEGVLMVEPQPAPITFATCFDSNSGA
YSVFK
 
Nucleotide Sequence: 438 bp     [Download]
>gi|253698656|ref|NC_012918.1|:1416981-1417418 Geobacter sp. M21 chromosome, complete genome
TTGCTGGACAGGCTCATTGCTGCTCCGGCACGCAGTGGGCCTGGCCAGGGCGGGGAGGGAGTCTTGGGTG
ACATCCTGGACTCCCTGCTTCGCGACCTGGAAAACCTTCTCAACACGAGGAGAAGTGTCCCGCTCGCGCC
GGACTGCAGGCAAGAGTCGCAGAAGTCCGTTCTCAGCTACGGCGGAAGGGATTTCAGCACGCACAACCCA
CGCACCGCCTTGGCCAGAGAGCAGATCCGGCTGGAGATACAGAGGTTGCTGCTGTCGTTCGAACCTCGTC
TTAAAGAGGCTGTGGTTCGGCTCGAAGCCATCCCTGAAACGGGCCGGACCCTGCAGTTCAGAATCGAGGG
GGTCTTGATGGTCGAACCGCAGCCGGCTCCGATTACCTTTGCCACCTGCTTCGACAGCAACAGCGGCGCC
TACTCCGTATTCAAGTGA