SecReT6
Protein ID: 253699841
SecReT6 ID354
T6SS typei4a
Gene symbol-
Locus tagGM21_1211
StrainGeobacter sp. M21
Repliconchromosome [GenBank: NC_012918] [Browse all T6SS(s) in this replicon]
Location [Strand]1417426..1419198 [+]
Producttype VI secretion protein
NoteTssF
UniProt IDC6E3K7
KEGG IDgem:GM21_1211
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 5.20E-203, Aligned region: 5..590
Protein Sequence: 590 a.a.     [Download]
>gi|253699841|ref|YP_003021030.1| type VI secretion protein [Geobacter sp. M21]
MGDDFLDYYEKELSFIREMGSEFARKYPGIAGRLLLEPDRCEDPHVERLIEAFALICARMHKKLDDDFPE
ITQSLLNVLYPHCTNPIPSLSVVRFSPLMKNVPDTGYLVPKGTTLFSRALDGVRCRFATAYPVTLWPMEV
AHAALADQVITIRLKLHNKVTFARFSSDSIRFYLNGQRQHTFQLYEQLLNNVSRIECVAVGKKIPPVALT
KNSIRPVGFDEQEMLLPFPRQSFKGYRLLLEYFAFPEKYLFLELSGLSSAPLGDFGDTLDLAIHLDHPTG
PSFPVSADTFCLHATPAVNLFSKIAEPIRIENRRAEYRVVPELRSPEAMEIFSIDQVSGMSDAPAPVTRV
YRPLYEITRPDGGSIGDVEGVWWLMQRKASGTAGDRGTEVFLSFCDLASDPADPPDETVTLRLTCSNRDL
PGALPWGDPAGDFDIEAAAPVEATNAVVRPTAVRRPALSGASQWRLISHLSLNHLSLLEADGAALKDMLR
LYDFEDSPATRQQTNGIVSVSFRHVTRRIGALICRGVEVTIEFDERQFVGSGVYLFASVLERFLGEYVSL
NSFVQLVAKSSQRKEVMKKWPPRNGDRVLL
 
Nucleotide Sequence: 1773 bp     [Download]
>gi|253698656|ref|NC_012918.1|:1417426-1419198 Geobacter sp. M21 chromosome, complete genome
ATGGGTGATGACTTCCTAGACTATTACGAAAAGGAACTCAGCTTCATTCGCGAGATGGGGAGCGAGTTCG
CCAGGAAATATCCGGGCATTGCGGGAAGGCTTCTGCTTGAGCCGGACAGGTGTGAGGACCCGCATGTCGA
GAGGCTCATCGAGGCCTTTGCCCTAATCTGCGCGAGGATGCACAAAAAGCTCGACGACGATTTCCCAGAG
ATCACGCAGTCCCTTCTGAACGTTCTTTACCCGCACTGCACGAACCCCATACCTTCCCTGTCGGTGGTCA
GATTCTCTCCCCTGATGAAGAACGTTCCGGATACCGGTTACCTGGTCCCGAAAGGGACGACCCTGTTTTC
CCGTGCGCTCGACGGCGTTCGCTGCCGGTTCGCCACCGCCTACCCCGTGACGCTCTGGCCTATGGAAGTG
GCGCATGCTGCGCTGGCGGATCAGGTCATCACCATCAGGCTGAAGCTGCACAACAAGGTAACCTTCGCGC
GCTTTTCCTCCGACAGCATCCGTTTCTACCTGAATGGCCAACGCCAGCACACCTTTCAGCTCTACGAGCA
GTTGCTCAATAACGTCTCCCGCATCGAATGCGTGGCGGTCGGGAAAAAGATCCCCCCGGTAGCGCTGACG
AAGAACAGCATCCGCCCGGTGGGATTTGACGAACAGGAGATGCTGCTCCCCTTCCCAAGGCAGTCGTTCA
AGGGGTACCGCCTGCTGTTGGAATACTTCGCCTTCCCGGAAAAGTACCTCTTCCTGGAACTGTCGGGACT
GTCTTCCGCGCCCCTCGGGGATTTCGGAGACACACTGGATCTGGCCATTCATCTGGACCACCCGACCGGA
CCTTCCTTCCCTGTCAGCGCTGATACCTTCTGTCTCCATGCCACCCCGGCCGTCAACCTCTTCAGCAAAA
TCGCCGAACCGATCCGGATCGAGAACCGTCGGGCAGAGTACCGGGTAGTCCCCGAGTTACGGTCCCCCGA
AGCGATGGAGATCTTCAGCATCGACCAGGTAAGCGGCATGTCCGATGCGCCCGCCCCGGTCACCAGGGTT
TACCGGCCCCTCTACGAAATTACCCGCCCCGACGGCGGAAGCATTGGCGACGTCGAGGGGGTGTGGTGGC
TGATGCAGCGCAAGGCTTCAGGGACAGCTGGGGATCGCGGTACCGAGGTCTTTCTCTCCTTTTGCGATCT
CGCTTCAGATCCCGCCGATCCGCCAGATGAAACCGTGACCCTGCGGCTGACCTGCAGCAACCGCGATCTT
CCCGGCGCGCTCCCCTGGGGGGATCCGGCCGGCGATTTCGATATCGAGGCTGCTGCGCCGGTCGAAGCGA
CCAATGCCGTGGTCAGGCCGACGGCTGTGCGTCGTCCCGCCTTGTCCGGGGCTTCGCAATGGCGGCTCAT
CTCGCATCTTTCCCTCAACCATCTTTCGCTTCTGGAAGCGGATGGGGCAGCGCTCAAGGACATGCTGAGG
CTGTACGACTTCGAGGATTCCCCCGCGACACGACAGCAGACAAATGGGATCGTGTCGGTCTCTTTCAGGC
ACGTCACCAGGAGGATCGGCGCTCTTATTTGTCGTGGCGTCGAAGTCACCATCGAGTTCGACGAGCGGCA
GTTTGTCGGGAGCGGGGTCTATCTTTTTGCCTCAGTCCTGGAGAGGTTTCTGGGAGAGTACGTCTCGCTG
AATTCCTTCGTGCAACTTGTCGCCAAGAGTAGCCAACGTAAGGAGGTCATGAAGAAATGGCCGCCTAGGA
ACGGGGACCGGGTGCTGCTGTGA