SecReT6
Protein ID: 253699842
SecReT6 ID354
T6SS typei4a
Gene symbol-
Locus tagGM21_1212
StrainGeobacter sp. M21
Repliconchromosome [GenBank: NC_012918] [Browse all T6SS(s) in this replicon]
Location [Strand]1419213..1420247 [+]
Producttype VI secretion protein
NoteTssG
UniProt IDC6E3K8
KEGG IDgem:GM21_1212
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 3.90E-82, Aligned region: 18..321
Protein Sequence: 344 a.a.     [Download]
>gi|253699842|ref|YP_003021031.1| type VI secretion protein [Geobacter sp. M21]
MRSAGTEGCPEARKRLLREFHRHSFYQAVNYLERSRFGGRDFGQAMSPKEEPVRFRARTGFSFPASDIAN
LEEGKDGAPPQMEVAFMGVVGPSGTLPNWYHELALERGRAKDPAMIAFYDLFHHRLISLFYLVWKRGRVM
PGKKSDHSDRFSNYLLNLIGLGTPGIAGVCSPGRVPLFFCGQISRNIPTAGMVAAVVQYQLGLTAEVEQF
VPRLIALEPEERTTVGEGNCVLGKNASCGGEVWESQTTFRLCLGPMFFREFNNMLPGGDRLASLVALVRY
LVGVEYEFEVRLVLKKEEVPTLKLGETGPDAPRLGLSMWMKTPGTTLSVDPYVTLREDDLARSV
 
Nucleotide Sequence: 1035 bp     [Download]
>gi|253698656|ref|NC_012918.1|:1419213-1420247 Geobacter sp. M21 chromosome, complete genome
ATGCGTTCCGCCGGGACCGAAGGATGTCCAGAAGCAAGAAAGCGCCTGTTGCGTGAGTTTCACCGCCATT
CCTTTTACCAGGCGGTGAATTATCTTGAGCGCAGCCGGTTTGGTGGGCGCGATTTCGGGCAGGCCATGAG
TCCGAAAGAAGAGCCGGTCCGGTTCCGTGCCCGCACCGGCTTTTCATTTCCTGCCAGTGACATAGCGAAC
CTGGAGGAGGGAAAGGACGGAGCCCCCCCGCAGATGGAAGTGGCGTTCATGGGAGTGGTCGGGCCGTCGG
GAACGCTCCCCAACTGGTACCACGAACTGGCGCTGGAGCGGGGCCGGGCGAAGGATCCGGCGATGATAGC
CTTTTACGATCTCTTCCATCACCGGCTCATCTCGCTTTTTTACCTTGTCTGGAAGCGAGGTCGCGTCATG
CCCGGCAAGAAGAGCGACCATTCAGACCGCTTTTCCAACTATCTACTCAACCTCATCGGGCTTGGAACAC
CGGGAATAGCCGGGGTCTGCTCTCCTGGACGAGTACCGCTTTTCTTCTGTGGACAGATCTCCCGAAACAT
CCCCACCGCTGGAATGGTAGCCGCGGTTGTGCAGTACCAGCTAGGCCTGACGGCGGAAGTGGAGCAGTTC
GTGCCCCGGCTGATCGCTTTGGAACCGGAGGAGAGGACGACCGTTGGAGAAGGCAATTGCGTGCTTGGTA
AAAATGCGAGCTGCGGCGGTGAAGTATGGGAGAGCCAGACTACCTTCCGCCTCTGTCTCGGCCCCATGTT
CTTTCGAGAGTTCAACAACATGCTACCCGGGGGGGACAGGCTAGCCTCGCTCGTCGCACTGGTCAGGTAT
CTGGTTGGCGTGGAGTACGAGTTCGAGGTGCGGCTGGTGTTAAAGAAGGAAGAAGTTCCAACGTTGAAGC
TGGGAGAAACAGGGCCGGATGCACCAAGGCTTGGGTTGTCGATGTGGATGAAGACGCCGGGGACGACGTT
GTCAGTCGATCCTTACGTGACACTGCGGGAAGACGATCTCGCCCGTTCCGTCTGA