SecReT6
Protein ID: 253699846
SecReT6 ID354
T6SS typei4a
Gene symbol-
Locus tagGM21_1216
StrainGeobacter sp. M21
Repliconchromosome [GenBank: NC_012918] [Browse all T6SS(s) in this replicon]
Location [Strand]1423171..1425222 [+]
ProductImpA family type VI secretion-associated protein
NoteTssI
UniProt IDC6E3L2
KEGG IDgem:GM21_1216
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 3.00E-78, Aligned region: 30..337
Phage_base_V [PF04717], Evalue: 3.40E-26, Aligned region: 372..465
Gp5_C [PF06715], Evalue: 0.0089, Aligned region: 56..63
Gp5_C [PF06715], Evalue: 0.0089, Aligned region: 546..569
Protein Sequence: 683 a.a.     [Download]
>gi|253699846|ref|YP_003021035.1| ImpA family type VI secretion-associated protein [Geobacter sp. M21]
MAYTQEEKLISIVTPLGPDVLLLTALSGAESLSKMFSFELSMVSENHAVSFDGIIGKSVTVTIQLADGGK
RYLNGIISSFSQGRGGGEEGGDARFSYYRATMVPWLWVLTKRSDCRIFQNQSAVEIVEEVFKGHGIGNFR
LELQSSYTPREFCVQYRETDFNFVSRLLEEEGIFYFFVHEAGKHILVLADTPGAHKPCPGQNTASCQLSA
SAVRDKDVIASFEITRQLGASKYIINDFNFKVPKAGLAVEVQGTDKRQVGNREIYEQPGGYDNKAAGDSL
AKVRMEEDEAHSIEIIGTSDCRSFTSGFRFTLKGHPRKDLSAQDYLLVSLHHKATEGYGDDGGAFYGNSF
NCLPYNVPYRPRRHTPKPVIHGTQTAIVVGPPGEEIYTDEYGRVKVQFHWDRAGKNDDKSSCWIRVSQSW
AGNGWGALQVPRVGQEVVVDFLEGDPDRPIIVGQLYNGVNLPPYSLPAHKTKSCTKSHSSPKGEGFNEIR
FEDKKGEEQLFIHAEKQQDNRVKGDSLEWVGEDRHLIVVRDQYLQVSGDQHFSVAGDRNEKVTGTVSITV
GADLQQKVGGKHALAAGGELHLKAGTRLIVESGTRISLKVGGSFIDIGPAGVSIVGPSVLINQGGTAGFG
SGASPDLPRPPKEADRSVGAKADGAVRGKPPEVGAQAASLKSAARDHKMFCNV
 
Nucleotide Sequence: 2052 bp     [Download]
>gi|253698656|ref|NC_012918.1|:1423171-1425222 Geobacter sp. M21 chromosome, complete genome
ATGGCCTACACGCAGGAAGAAAAACTTATCTCTATAGTCACTCCGCTTGGCCCTGACGTGTTACTACTGA
CGGCCCTTAGCGGAGCAGAAAGCCTCTCCAAGATGTTCAGCTTCGAGCTCTCTATGGTCTCTGAGAACCA
TGCCGTTTCTTTCGATGGGATCATCGGCAAAAGCGTGACCGTTACCATCCAGCTGGCAGACGGCGGTAAG
CGGTACCTCAACGGAATCATCTCCAGTTTCTCGCAAGGAAGAGGCGGGGGAGAAGAGGGGGGGGACGCGA
GGTTCAGCTACTACCGCGCCACCATGGTCCCGTGGTTATGGGTGCTGACCAAAAGATCCGACTGCAGGAT
CTTTCAGAACCAGTCGGCGGTAGAGATCGTGGAGGAAGTATTCAAAGGCCACGGCATCGGCAACTTCCGC
CTTGAGCTTCAGTCCAGCTACACCCCCCGTGAATTTTGCGTCCAATACCGTGAGACCGACTTCAATTTCG
TCTCCCGCCTGCTTGAGGAAGAAGGCATCTTTTACTTCTTCGTGCACGAGGCCGGCAAGCACATTTTGGT
ACTTGCCGACACTCCCGGAGCACATAAACCATGTCCCGGGCAAAATACCGCGTCCTGCCAATTAAGCGCC
AGCGCCGTCAGGGATAAGGATGTGATCGCCTCCTTTGAAATCACCAGGCAACTCGGCGCCTCCAAGTACA
TCATCAACGACTTCAACTTCAAAGTACCGAAAGCGGGTCTCGCTGTCGAAGTGCAAGGGACGGACAAACG
ACAGGTCGGGAATCGCGAGATCTATGAACAGCCGGGAGGCTATGACAACAAAGCGGCCGGCGATTCATTG
GCGAAAGTGCGCATGGAGGAAGACGAAGCGCATTCAATCGAGATCATCGGCACCAGTGACTGCCGCAGTT
TTACCTCCGGTTTCCGGTTCACCCTCAAAGGGCACCCTCGCAAAGATCTGAGCGCACAAGATTACCTCCT
GGTGTCGTTGCATCATAAGGCTACTGAAGGATACGGAGACGATGGCGGGGCTTTCTACGGAAACAGCTTC
AATTGCCTGCCTTACAACGTCCCCTACCGCCCGCGCCGCCATACACCGAAGCCTGTCATACATGGCACGC
AGACCGCGATCGTTGTCGGGCCGCCGGGAGAGGAGATCTACACCGACGAATACGGCAGGGTCAAGGTGCA
GTTCCACTGGGACCGAGCTGGAAAAAACGACGACAAAAGTTCCTGCTGGATCAGGGTGAGCCAGTCTTGG
GCAGGGAACGGTTGGGGAGCGCTTCAGGTACCTCGCGTAGGGCAGGAGGTTGTCGTGGATTTCCTGGAAG
GGGATCCCGATCGGCCCATCATAGTAGGGCAGCTCTACAACGGGGTGAACCTGCCGCCGTACTCTCTGCC
CGCGCACAAGACAAAAAGCTGCACGAAGTCGCACTCCTCCCCCAAGGGGGAGGGCTTCAACGAAATCCGG
TTCGAGGACAAAAAAGGTGAGGAGCAACTGTTCATTCACGCGGAAAAGCAGCAGGACAACCGGGTAAAGG
GGGACTCCCTGGAATGGGTGGGGGAGGATCGTCATCTGATCGTCGTGCGGGACCAGTACCTGCAGGTTTC
GGGAGACCAGCATTTTTCCGTGGCAGGAGACCGCAACGAGAAAGTGACGGGAACAGTATCAATCACCGTC
GGCGCAGACCTGCAGCAAAAGGTCGGCGGAAAACATGCGCTGGCCGCAGGAGGGGAGCTCCATCTCAAAG
CCGGGACGAGACTTATCGTTGAGTCAGGGACCAGGATCTCCCTCAAGGTCGGCGGCAGCTTTATCGACAT
CGGCCCGGCCGGTGTGAGCATAGTCGGGCCTTCCGTTCTCATCAACCAAGGGGGGACAGCCGGGTTCGGT
TCCGGAGCAAGTCCCGACCTGCCGCGGCCGCCGAAAGAGGCGGACAGATCCGTTGGCGCAAAAGCCGATG
GGGCAGTGCGCGGCAAACCGCCGGAGGTGGGCGCCCAGGCGGCGTCACTGAAATCGGCAGCAAGAGACCA
TAAGATGTTTTGCAATGTCTGA