SecReT6
Protein ID: 253989748
SecReT6 ID356
T6SS typei4b
Gene symbol-
Locus tagPAU_02268
StrainPhotorhabdus asymbiotica subsp. asymbiotica ATCC 43949
Repliconchromosome [GenBank: NC_012962] [Browse all T6SS(s) in this replicon]
Location [Strand]2568403..2570973 [-]
ProductClpA/B-type chaperone
NoteTssH
UniProt IDB6VKY5
KEGG IDpay:PAU_02268
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.10E-42, Aligned region: 213..291
AAA_2 [PF07724], Evalue: 1.10E-42, Aligned region: 579..752
AAA [PF00004], Evalue: 1.20E-21, Aligned region: 215..328
AAA [PF00004], Evalue: 1.20E-21, Aligned region: 584..706
AAA_5 [PF07728], Evalue: 9.40E-14, Aligned region: 215..291
AAA_5 [PF07728], Evalue: 9.40E-14, Aligned region: 289..345
AAA_5 [PF07728], Evalue: 9.40E-14, Aligned region: 583..704
ClpB_D2-small [PF10431], Evalue: 2.10E-11, Aligned region: 760..837
AAA_16 [PF13191], Evalue: 4.30E-10, Aligned region: 132..191
AAA_16 [PF13191], Evalue: 4.30E-10, Aligned region: 192..237
AAA_16 [PF13191], Evalue: 4.30E-10, Aligned region: 260..294
AAA_16 [PF13191], Evalue: 4.30E-10, Aligned region: 417..470
AAA_16 [PF13191], Evalue: 4.30E-10, Aligned region: 576..622
AAA_16 [PF13191], Evalue: 4.30E-10, Aligned region: 649..672
AAA_22 [PF13401], Evalue: 2.30E-08, Aligned region: 142..182
AAA_22 [PF13401], Evalue: 2.30E-08, Aligned region: 215..308
AAA_22 [PF13401], Evalue: 2.30E-08, Aligned region: 332..382
AAA_22 [PF13401], Evalue: 2.30E-08, Aligned region: 581..671
IstB_IS21 [PF01695], Evalue: 5.30E-08, Aligned region: 195..245
IstB_IS21 [PF01695], Evalue: 5.30E-08, Aligned region: 567..604
Sigma54_activat [PF00158], Evalue: 1.30E-07, Aligned region: 209..234
Sigma54_activat [PF00158], Evalue: 1.30E-07, Aligned region: 576..703
AAA_14 [PF13173], Evalue: 3.90E-07, Aligned region: 215..350
AAA_14 [PF13173], Evalue: 3.90E-07, Aligned region: 582..678
AAA_25 [PF13481], Evalue: 4.90E-07, Aligned region: 210..239
AAA_25 [PF13481], Evalue: 4.90E-07, Aligned region: 268..311
AAA_25 [PF13481], Evalue: 4.90E-07, Aligned region: 464..516
AAA_25 [PF13481], Evalue: 4.90E-07, Aligned region: 578..608
Arch_ATPase [PF01637], Evalue: 5.50E-07, Aligned region: 194..235
Arch_ATPase [PF01637], Evalue: 5.50E-07, Aligned region: 266..313
Arch_ATPase [PF01637], Evalue: 5.50E-07, Aligned region: 582..623
Arch_ATPase [PF01637], Evalue: 5.50E-07, Aligned region: 654..678
AAA_19 [PF13245], Evalue: 2.30E-06, Aligned region: 213..235
AAA_19 [PF13245], Evalue: 2.30E-06, Aligned region: 579..605
AAA_17 [PF13207], Evalue: 2.90E-05, Aligned region: 216..281
AAA_17 [PF13207], Evalue: 2.90E-05, Aligned region: 480..514
AAA_17 [PF13207], Evalue: 2.90E-05, Aligned region: 583..618
AAA_18 [PF13238], Evalue: 3.10E-05, Aligned region: 215..240
AAA_18 [PF13238], Evalue: 3.10E-05, Aligned region: 451..507
AAA_18 [PF13238], Evalue: 3.10E-05, Aligned region: 585..610
T2SE [PF00437], Evalue: 4.20E-05, Aligned region: 187..237
T2SE [PF00437], Evalue: 4.20E-05, Aligned region: 568..621
NACHT [PF05729], Evalue: 5.30E-05, Aligned region: 215..244
NACHT [PF05729], Evalue: 5.30E-05, Aligned region: 584..607
AAA_29 [PF13555], Evalue: 6.70E-05, Aligned region: 207..231
AAA_29 [PF13555], Evalue: 6.70E-05, Aligned region: 577..606
Zeta_toxin [PF06414], Evalue: 7.50E-05, Aligned region: 215..235
Zeta_toxin [PF06414], Evalue: 7.50E-05, Aligned region: 582..633
UPF0079 [PF02367], Evalue: 0.0002, Aligned region: 215..235
UPF0079 [PF02367], Evalue: 0.0002, Aligned region: 572..606
TIP49 [PF06068], Evalue: 0.00024, Aligned region: 215..254
TIP49 [PF06068], Evalue: 0.00024, Aligned region: 264..295
TIP49 [PF06068], Evalue: 0.00024, Aligned region: 582..618
AAA_11 [PF13086], Evalue: 0.0005, Aligned region: 131..178
AAA_11 [PF13086], Evalue: 0.0005, Aligned region: 214..501
AAA_11 [PF13086], Evalue: 0.0005, Aligned region: 572..726
RNA_helicase [PF00910], Evalue: 0.00051, Aligned region: 151..183
RNA_helicase [PF00910], Evalue: 0.00051, Aligned region: 216..236
RNA_helicase [PF00910], Evalue: 0.00051, Aligned region: 584..605
Clp_N [PF02861], Evalue: 0.00054, Aligned region: 23..46
DUF258 [PF03193], Evalue: 0.0012, Aligned region: 210..234
DUF258 [PF03193], Evalue: 0.0012, Aligned region: 572..597
MobB [PF03205], Evalue: 0.0041, Aligned region: 216..238
MobB [PF03205], Evalue: 0.0041, Aligned region: 582..615
DUF815 [PF05673], Evalue: 0.0042, Aligned region: 208..290
DUF815 [PF05673], Evalue: 0.0042, Aligned region: 583..620
AAA_28 [PF13521], Evalue: 0.0046, Aligned region: 216..245
AAA_28 [PF13521], Evalue: 0.0046, Aligned region: 583..606
SRP54 [PF00448], Evalue: 0.0054, Aligned region: 214..238
SRP54 [PF00448], Evalue: 0.0054, Aligned region: 582..606
Hpr_kinase_C [PF07475], Evalue: 0.0091, Aligned region: 215..227
Hpr_kinase_C [PF07475], Evalue: 0.0091, Aligned region: 580..601
Protein Sequence: 856 a.a.     [Download]
>gi|253989748|ref|YP_003041104.1| ClpA/B-type chaperone [Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949]
MSNYLKQIVGKLTVEARQCLDEAANLAVRRTHHEVEIEHLLLALFEKQMPMMEQVCHHGGIDAIALLNAC
QRSLTLLRSGNHRPPVFSTNLTEWMEQSWMYASTRSYLGSLQITAQALIVTLLVNPSLQHSLTSELQQAL
QCNSDAIEQWLCTQVHPEPQQMTTTRDNTQSALSQYAHHLTQAARDNKLDPVLGREREIRQLIDVLLRRR
QNNPLLTGDAGVGKTALIEGLAQRIVDGRVPEVLTQAELFTLDMGLLQAGASVKGEFESRLQNLLDEVKE
YPAPVILFIDEAHTLIGAGGQAGQNDAANLLKPALARGELRAIAATTWAEYKKYFEKDAALARRFQVIKV
EEPSLELATAMLRAITPAMEKHHGVKILAEAVTEAVTLASRYISGRQLPDKSVSLLDSACARVSVSQTDE
PAPIEDLRAMLANIATEQAALLREGGHETQLKKLAQRQAELQASLEEILPEYHIQRQLVNDILTCEEHDE
QLPKLRAELHQRHRQHAYVFDCVDAACVADIVAGWTGIPLGRMVENERDVLRQLETRLGQRVMGQDHALS
QIARQIRIAKAQLADPVKPTGVFMLAGPSGVGKTETALALAHELYGGERHMITINMSEYQEAHSVSGLKG
SPPGYVGYGQGGVLTEAVRRQPYSVVLLDEVEKAHPDVLELFFQVFDKGMMEDAEGQQINFRNTLIILTT
NAASDLVMRAAMHGVKEQGENRPATLEDIQEIIQPELQRIFTPAFLGRLQVIPYLPVHGEVLHAIVRHKL
NKVVGRYHQATQCELHYSDGLVNFIAEECRIAESGAREIDNLLMQFVLPLLSDQLLLGDTPVNEDVRLDV
MDNKVQLLSDKTELSP
 
Nucleotide Sequence: 2571 bp     [Download]
>gi|253987483|ref|NC_012962.1|:c2570973-2568403 Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949 chromosome, complete genome
GTGAGTAATTATCTGAAACAGATCGTGGGTAAATTAACGGTGGAGGCGCGTCAGTGTCTTGATGAGGCTG
CTAATTTGGCGGTACGACGCACCCATCATGAAGTGGAAATTGAGCATTTGCTGCTAGCTTTGTTTGAAAA
ACAGATGCCGATGATGGAGCAGGTATGTCATCACGGTGGTATTGATGCTATCGCGCTACTGAATGCTTGC
CAGCGGTCGCTGACGCTATTGCGTAGTGGTAATCATCGTCCGCCAGTATTCTCTACCAATCTGACAGAGT
GGATGGAACAGTCATGGATGTACGCCAGCACTCGTTCTTATTTGGGATCGTTGCAGATTACCGCTCAGGC
GTTGATTGTGACATTACTCGTCAACCCATCACTGCAACATTCGCTCACATCGGAACTGCAACAGGCGTTA
CAGTGTAACTCTGATGCGATAGAACAGTGGTTGTGTACACAGGTGCATCCAGAACCACAGCAAATGACGA
CTACCAGGGATAATACGCAATCCGCATTGTCTCAATATGCTCATCATCTAACGCAGGCGGCACGTGATAA
TAAACTGGACCCGGTACTGGGACGTGAGCGGGAGATTCGTCAATTAATTGACGTGTTGCTGCGCCGTCGT
CAAAACAACCCACTGTTAACCGGTGACGCGGGGGTCGGTAAGACGGCTTTGATAGAGGGACTTGCTCAAC
GTATTGTCGATGGCCGTGTACCGGAGGTGTTAACGCAAGCCGAATTATTCACACTTGACATGGGGCTATT
GCAGGCAGGTGCTAGCGTGAAAGGTGAATTTGAAAGTCGCCTGCAAAACTTATTGGATGAGGTGAAAGAA
TATCCTGCACCCGTGATTTTGTTTATTGATGAAGCGCACACTTTGATTGGTGCTGGTGGTCAAGCCGGGC
AAAACGATGCGGCTAATTTGTTGAAGCCAGCGTTGGCTCGGGGGGAATTGCGGGCGATTGCTGCAACTAC
CTGGGCCGAATATAAGAAATACTTTGAAAAAGACGCCGCGTTAGCCCGTCGTTTTCAGGTGATTAAAGTT
GAAGAACCTTCTCTGGAACTGGCTACAGCTATGTTACGTGCCATAACACCGGCTATGGAAAAACATCATG
GCGTCAAAATACTCGCTGAAGCGGTAACAGAAGCCGTGACATTAGCCAGTCGTTATATCAGTGGGCGTCA
GTTGCCGGATAAATCAGTCAGCCTGTTGGATAGCGCCTGTGCCCGCGTCTCAGTTTCACAGACTGACGAA
CCTGCACCTATTGAAGATTTACGTGCCATGCTGGCAAATATTGCTACTGAACAGGCAGCATTATTACGTG
AAGGTGGTCATGAAACTCAGTTAAAGAAATTGGCACAACGTCAGGCCGAATTACAGGCTTCACTGGAAGA
AATTTTGCCGGAATATCACATTCAGCGTCAGTTAGTGAATGACATCCTCACTTGTGAAGAACATGACGAA
CAGCTACCCAAACTGCGAGCAGAACTGCATCAACGCCATCGCCAACATGCCTATGTATTTGACTGTGTTG
ATGCAGCTTGCGTAGCGGATATTGTTGCCGGCTGGACGGGGATACCGCTTGGCCGGATGGTAGAAAATGA
ACGTGATGTACTGCGTCAACTCGAAACGCGCCTCGGTCAGCGGGTAATGGGGCAAGATCATGCGCTCAGT
CAGATAGCGCGTCAAATTCGGATTGCCAAAGCGCAACTGGCTGATCCGGTCAAGCCTACTGGCGTATTTA
TGCTTGCAGGTCCTTCTGGTGTTGGAAAAACGGAAACCGCTCTGGCATTAGCTCATGAATTGTATGGTGG
TGAACGTCATATGATCACGATCAATATGTCGGAATATCAAGAGGCTCATTCTGTTTCTGGCTTGAAAGGT
TCTCCTCCAGGGTATGTCGGTTATGGACAAGGTGGCGTGTTGACCGAAGCAGTTCGGCGTCAACCTTACA
GTGTGGTATTACTCGATGAAGTGGAGAAGGCGCATCCTGATGTGTTGGAACTGTTCTTTCAGGTGTTTGA
TAAGGGCATGATGGAAGATGCAGAAGGGCAGCAGATTAATTTCCGCAATACGTTGATTATTCTTACCACT
AATGCGGCATCGGATTTGGTGATGCGGGCAGCGATGCATGGGGTAAAAGAGCAGGGTGAAAATCGCCCGG
CAACACTTGAAGATATTCAGGAGATTATCCAACCGGAACTGCAACGGATTTTTACTCCCGCATTTTTAGG
CCGTTTGCAGGTTATTCCTTATTTGCCAGTACATGGCGAAGTTCTGCATGCCATTGTGCGTCATAAACTG
AATAAAGTGGTTGGGCGTTACCATCAAGCAACTCAGTGTGAACTGCACTATAGCGACGGGCTGGTAAATT
TCATCGCTGAAGAGTGCCGGATCGCAGAAAGTGGGGCACGTGAAATTGATAACTTGTTAATGCAGTTTGT
TCTACCGTTGTTATCGGATCAATTGTTATTGGGGGATACACCAGTGAATGAGGATGTTCGGTTGGATGTT
ATGGACAATAAAGTACAGTTATTATCAGATAAAACCGAATTATCACCATAG