SecReT6
Protein ID: 253989750
SecReT6 ID356
T6SS typei4b
Gene symbol-
Locus tagPAU_02270
StrainPhotorhabdus asymbiotica subsp. asymbiotica ATCC 43949
Repliconchromosome [GenBank: NC_012962] [Browse all T6SS(s) in this replicon]
Location [Strand]2574482..2575105 [-]
Producttransmembrane protein
NoteTssL
UniProt IDB6VKY3
KEGG IDpay:PAU_02270
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.90E-35, Aligned region: 3..202
Protein Sequence: 207 a.a.     [Download]
>gi|253989750|ref|YP_003041106.1| transmembrane protein [Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949]
MMRLLDCYIPVFTCVLRMIQQQVNQAEELRQTLLAALTQAQNEAQRYGYGLQDIEEANFAVVVWADEAIL
CAGQKELHVWRQSSLQAQLYNAELGGNTFFDRLAALSPDNYQVRLVYVFCLLSGFYGRYGRRDNLELHNI
IQQELDNFPDTLRRYIATKNHRIMNTGDNILENKRPNNKWRRKLILLILSLISIYIFITVYLLNISR
 
Nucleotide Sequence: 624 bp     [Download]
>gi|253987483|ref|NC_012962.1|:c2575105-2574482 Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949 chromosome, complete genome
GTGATGCGCTTATTGGATTGTTACATTCCGGTATTTACCTGTGTGTTGCGTATGATCCAGCAACAGGTGA
ATCAAGCCGAAGAGCTACGGCAAACATTGTTAGCCGCGTTGACGCAGGCGCAGAATGAAGCGCAACGGTA
TGGTTATGGATTGCAAGATATTGAAGAGGCGAATTTCGCAGTGGTGGTTTGGGCCGACGAAGCTATTTTA
TGCGCAGGTCAGAAAGAATTGCATGTTTGGCGGCAGTCATCATTGCAGGCGCAGCTTTATAATGCTGAAC
TTGGCGGAAATACCTTTTTTGATCGTCTGGCAGCGTTATCCCCGGATAATTATCAAGTTCGATTGGTTTA
TGTTTTTTGCTTGCTTTCTGGATTTTATGGACGTTATGGCAGACGTGATAATTTGGAATTGCACAATATT
ATCCAACAAGAATTAGATAATTTTCCTGATACTTTGCGTCGTTATATTGCCACAAAAAATCACAGGATCA
TGAACACGGGCGATAATATTCTGGAAAATAAACGACCTAATAATAAATGGCGTAGGAAGTTAATATTATT
AATATTGTCGCTTATCTCAATTTATATTTTTATCACAGTTTACTTATTGAATATTAGCCGATAA