SecReT6
Protein ID: 253989751
SecReT6 ID356
T6SS typei4b
Gene symbol-
Locus tagPAU_02271
StrainPhotorhabdus asymbiotica subsp. asymbiotica ATCC 43949
Repliconchromosome [GenBank: NC_012962] [Browse all T6SS(s) in this replicon]
Location [Strand]2575102..2576499 [-]
Producthypothetical protein
NoteTssK
UniProt IDB6VKY2
KEGG IDpay:PAU_02271
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 9.90E-96, Aligned region: 19..463
Protein Sequence: 465 a.a.     [Download]
>gi|253989751|ref|YP_003041107.1| hypothetical protein PAU_02271 [Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949]
MFEHKPMYWYSGLYLQPQHFQAHELQHEYWQGRYQLLTQPYAFGVVRLVFNLAALSDEVLSIHKAVFVFP
DGCYVDCDVNGVLSARSLRNCWPEREKPQRIYVGLRTFNHNQSNVTGVVDADSVGNITSRWVTWPQEQRM
RDAFGEGPEAEVQQLTYNLRFFLHDEIAQATGYTLLPVGQLHCTSDGIELDNRYLPPCLTLYAVSQLGQR
IDQLCQELTGRVHQLEELKRPQTLEAEVYTQEKSTLLLTLRTLVRYVVQLHHCQETRDVHPLQIFGLLRQ
LISELSCFTDRCSFLGEWNGREETLEKYQHQDLALTFNSCERTIIDLLNALVLEPNTVIPLQQECNGYYH
AAFNVTGASEQQRIYLVLRSDNLTDSEREIPDDRLIKLAAAEQIDGIINRALPGVRLYYQEIAPHGLPNR
MNTHYFRVENRGTLWRQVEDSERVAVHWADAPDDLQIEIVIVRVS
 
Nucleotide Sequence: 1398 bp     [Download]
>gi|253987483|ref|NC_012962.1|:c2576499-2575102 Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949 chromosome, complete genome
ATGTTTGAACATAAACCGATGTATTGGTATTCAGGATTGTATTTACAACCACAACATTTTCAGGCGCATG
AATTGCAACATGAATATTGGCAAGGACGTTATCAATTATTGACTCAACCTTATGCTTTCGGTGTTGTGAG
GTTGGTGTTCAATCTGGCCGCGCTGAGTGATGAAGTACTCAGTATTCATAAAGCCGTGTTCGTTTTTCCG
GATGGCTGTTATGTGGATTGTGATGTGAATGGTGTGCTCAGTGCTCGCTCACTGCGCAACTGTTGGCCGG
AACGTGAAAAACCACAGCGCATTTATGTTGGCCTGCGGACGTTTAACCATAACCAGAGTAATGTCACCGG
TGTCGTGGATGCTGACAGTGTAGGTAATATCACTAGCCGTTGGGTGACATGGCCGCAAGAGCAACGGATG
CGGGATGCGTTTGGTGAGGGACCAGAGGCAGAAGTGCAGCAACTCACTTATAACTTACGTTTTTTTCTAC
ATGATGAAATTGCACAGGCAACGGGTTATACATTGTTACCTGTGGGTCAACTGCATTGTACTAGTGATGG
CATTGAACTGGATAACCGCTACTTGCCGCCCTGTTTGACGTTATACGCTGTGTCACAACTGGGACAGCGT
ATTGATCAACTTTGTCAGGAATTGACAGGACGTGTCCATCAACTGGAAGAGCTAAAGCGCCCGCAAACAT
TGGAAGCGGAAGTTTATACTCAGGAAAAAAGTACATTATTGCTGACATTGCGTACTCTGGTGCGTTATGT
CGTGCAGTTGCATCACTGCCAGGAGACGCGTGATGTTCATCCTTTGCAGATTTTTGGGCTATTGCGTCAA
CTGATCAGTGAGCTTTCCTGTTTTACCGACCGTTGCTCTTTTTTAGGGGAATGGAACGGACGAGAGGAGA
CGTTGGAGAAATATCAGCATCAGGATTTAGCTTTGACGTTCAATAGCTGTGAACGAACCATTATCGACCT
GCTCAATGCACTGGTATTGGAACCGAACACGGTGATCCCGCTGCAACAGGAATGCAATGGTTATTATCAT
GCAGCGTTCAACGTAACAGGCGCAAGTGAACAGCAACGGATCTATTTGGTGCTGCGCTCTGACAACTTAA
CTGACAGCGAACGTGAAATTCCTGATGATCGTTTAATTAAGCTGGCGGCAGCGGAACAGATTGACGGCAT
TATTAATCGCGCTTTACCTGGAGTGCGCTTGTATTACCAGGAGATTGCCCCCCATGGTTTACCTAACCGA
ATGAATACTCATTATTTCCGGGTAGAAAATCGGGGAACGCTGTGGCGGCAGGTAGAAGATAGCGAACGCG
TAGCGGTGCACTGGGCTGATGCGCCAGACGATTTACAGATAGAAATCGTTATAGTGAGAGTGTCGTGA