SecReT6
Protein ID: 253989752
SecReT6 ID356
T6SS typei4b
Gene symbol-
Locus tagPAU_02272
StrainPhotorhabdus asymbiotica subsp. asymbiotica ATCC 43949
Repliconchromosome [GenBank: NC_012962] [Browse all T6SS(s) in this replicon]
Location [Strand]2576505..2577164 [-]
Producthypothetical protein
NoteTssJ
UniProt IDB6VKY1
KEGG IDpay:PAU_02272
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.30E-21, Aligned region: 22..160
Protein Sequence: 219 a.a.     [Download]
>gi|253989752|ref|YP_003041108.1| hypothetical protein PAU_02272 [Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949]
MKNKTNFYNVIKRSFSVLLIIFLINGCSDSISNNEKRLQAIEQARPVYANNAIRLKMTADPQLNVFNNMP
NSCTILIAQAEKREQLDKLLANPTLLRNLFAGTGATENILQLDNYVMMPGQSVSLHIDRAEQARYIALIA
GYYPAPDSAHVRVLSLPLRLEQRGWWNKSWNAEFVPMNIDLMLGRYAITRSNVSAGNAGDEVIFPEQTAE
SDNRNLLRK
 
Nucleotide Sequence: 660 bp     [Download]
>gi|253987483|ref|NC_012962.1|:c2577164-2576505 Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949 chromosome, complete genome
ATGAAGAATAAGACGAATTTTTATAATGTTATTAAACGTAGTTTCTCAGTATTACTAATAATTTTTTTAA
TCAATGGTTGCAGTGATTCAATTTCTAATAATGAAAAACGATTACAGGCAATTGAACAAGCCAGACCTGT
TTATGCTAATAATGCCATTCGTTTAAAAATGACGGCTGATCCGCAGCTGAACGTTTTTAATAATATGCCC
AATAGTTGTACGATATTAATTGCTCAGGCGGAGAAACGTGAACAATTGGATAAATTACTGGCTAATCCCA
CGCTATTACGTAATTTATTTGCTGGCACGGGTGCAACCGAAAATATATTACAGCTTGATAATTATGTGAT
GATGCCGGGGCAATCTGTATCTTTACATATTGATAGAGCGGAACAGGCACGTTATATCGCGCTGATTGCC
GGTTATTATCCCGCCCCAGATAGTGCACATGTGCGGGTATTATCGTTACCGTTACGTCTTGAACAACGCG
GTTGGTGGAATAAATCCTGGAATGCTGAGTTTGTTCCTATGAATATTGATTTAATGCTGGGGCGTTATGC
CATTACCCGGAGTAATGTCTCTGCGGGTAATGCGGGGGATGAGGTGATTTTCCCTGAGCAGACAGCTGAA
TCTGATAATCGGAATTTGTTAAGGAAGTAA