SecReT6
Protein ID: 253989753
SecReT6 ID356
T6SS typei4b
Gene symbol-
Locus tagPAU_02273
StrainPhotorhabdus asymbiotica subsp. asymbiotica ATCC 43949
Repliconchromosome [GenBank: NC_012962] [Browse all T6SS(s) in this replicon]
Location [Strand]2577154..2578272 [-]
Productinner membrane protein
NoteTssA
UniProt IDB6VKY0
KEGG IDpay:PAU_02273
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.80E-22, Aligned region: 65..126
ImpA-rel_N [PF06812], Evalue: 1.80E-22, Aligned region: 184..213
Protein Sequence: 372 a.a.     [Download]
>gi|253989753|ref|YP_003041109.1| inner membrane protein [Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949]
MPEREIRVNLAQTDIARFLHPISADAPAGCDIEYEPLFEQINAAREADEDLPQDDEWGYETRQADWPQVS
VLCQEVLEKHSKDLQIACWLTQAQGKLYGLAGMAGGMTLIASLLETFWSVLYPPLDNEEGNCADARLGRL
SWLDKQLVKQLDNLTLTSDGKLSLSVWQRVQYFEQRVAANSELRASLISDGYFGIAECDDSIRATLAEQF
DQLLAQAEQVKQALEKLHQIMVNLMPDAGNSMSFSTQRLQEMMALITRFHEIVAPEDAQQYHDEEALPGG
RASNGINTTLAEDRSHHEIRAIAIGQMINIANYFRKNEPTSPVPYLMERAARWANMGIAEWLEEMMEDNT
SALQDIMRVIKGPDKNREQDEE
 
Nucleotide Sequence: 1119 bp     [Download]
>gi|253987483|ref|NC_012962.1|:c2578272-2577154 Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949 chromosome, complete genome
TTGCCTGAAAGGGAAATAAGAGTGAATTTAGCACAGACAGACATCGCACGTTTTTTACATCCTATCTCTG
CTGATGCACCCGCGGGATGTGATATCGAATATGAACCTCTTTTTGAACAGATAAACGCTGCGCGTGAAGC
AGATGAGGATCTCCCACAGGATGATGAGTGGGGATATGAAACCCGGCAGGCTGACTGGCCTCAGGTTTCA
GTGTTGTGTCAGGAAGTACTGGAAAAACACAGTAAAGACTTACAGATAGCTTGTTGGTTAACTCAGGCAC
AGGGAAAGCTGTATGGTTTAGCTGGCATGGCTGGCGGTATGACATTAATTGCCAGCCTACTGGAAACCTT
TTGGTCAGTACTGTATCCGCCGTTGGATAATGAAGAGGGAAACTGTGCTGATGCCCGTCTTGGTCGGTTG
AGTTGGTTGGATAAACAACTGGTAAAACAATTGGACAACCTGACACTGACGAGTGATGGTAAGTTGAGTC
TGAGCGTTTGGCAGCGGGTGCAGTATTTTGAACAACGCGTTGCGGCTAATAGTGAATTACGCGCCTCCCT
GATCAGTGATGGCTATTTCGGTATCGCTGAATGTGATGACAGTATTCGCGCTACGCTTGCTGAACAATTT
GACCAACTATTGGCTCAGGCTGAACAAGTCAAGCAGGCATTGGAAAAACTGCACCAAATTATGGTGAACT
TGATGCCAGATGCTGGCAACAGCATGAGCTTCAGCACACAACGATTACAGGAGATGATGGCATTAATCAC
GCGTTTTCATGAGATTGTTGCGCCGGAAGACGCGCAACAATACCACGATGAGGAAGCGTTACCAGGAGGA
AGAGCGTCAAATGGTATTAATACGACGTTGGCAGAAGATCGGTCACATCATGAAATACGCGCTATTGCCA
TTGGGCAGATGATCAATATCGCCAATTATTTTCGTAAGAACGAACCCACCAGCCCAGTACCCTATTTAAT
GGAACGGGCAGCACGCTGGGCAAATATGGGAATAGCCGAATGGCTGGAGGAAATGATGGAAGATAATACC
TCAGCGCTACAGGACATTATGCGCGTGATAAAAGGACCAGATAAAAATAGAGAGCAAGATGAAGAATAA