SecReT6
Protein ID: 253989756
SecReT6 ID356
T6SS typei4b
Gene symbol-
Locus tagPAU_02276
StrainPhotorhabdus asymbiotica subsp. asymbiotica ATCC 43949
Repliconchromosome [GenBank: NC_012962] [Browse all T6SS(s) in this replicon]
Location [Strand]2579195..2581201 [-]
Producthypothetical protein
NoteTssI
UniProt IDB6VKX7
KEGG IDpay:PAU_02276
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 5.00E-60, Aligned region: 28..323
Phage_base_V [PF04717], Evalue: 5.10E-22, Aligned region: 357..450
Protein Sequence: 668 a.a.     [Download]
>gi|253989756|ref|YP_003041112.1| hypothetical protein PAU_02276 [Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949]
MLLGQKNRFLQVIGSLSDIVALNKISGEEHLSRPYSFSVQLYSSSDWNKLEPYIGKPLAFRIGEAPNHRI
VHGILTELQQQGFADGQFCYQARVEPWLKMLTLTSNLRVYQRISVPDMVCDIFRKRGFNDVELALKSRYP
KLEYCMQYKESDFDFVTRQLEQAGIFYFFRHEEGRHVLVLADHPSTFVNAPLAVLPYQSKLGSQQGYGLR
AWQIHRTMIPGMAEMSGYNVKNASTVSASAKANSGYSINPKLSIYDDRRQEERNQLEAQAALCMEQWESQ
SHYANAVNSYPGLQVGHQFTLKGHVSADGRYAVGSQQLKAESNLEEGGLLFSSQVTLFPANKTFRPRPSV
TRPYIAGVLSALVVGAASEEIHTDAQGRIKIQFHWDKEHKKNDDSSCWVRVSQFWNGAKFGAQFVPRVGS
EVLVSFVDGDPDSPLVTGTVYNGVKMPPFALPGQKTQSGIATRSSAKGTVEQGHQFCFEDKKGEEFILLH
SQKDLRLKVKNDFSANIDRNASWEIAEKRDTKIKKGNDTLILGEGNAVTEVKKGDKKQTLDHGNFTTTVS
AGSYSLEVSRGSAKINAGQHCTITANQGIELKVGASKLSITPAGITIKAPSVTVEGSGKLALKSSGVAEL
TGTTVKVQGSAMAQLKGGIVQVDATGIAMVKGILTKIG
 
Nucleotide Sequence: 2007 bp     [Download]
>gi|253987483|ref|NC_012962.1|:c2581201-2579195 Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949 chromosome, complete genome
ATGCTGTTAGGGCAAAAGAATCGTTTTTTACAGGTTATCGGCAGTCTGTCAGATATTGTGGCACTGAATA
AAATCAGCGGCGAAGAACACTTGTCTCGTCCTTATTCCTTTTCAGTCCAGCTCTACTCCAGTTCGGATTG
GAACAAGTTAGAGCCTTATATTGGTAAACCACTGGCATTTCGTATTGGTGAAGCACCAAATCACCGGATT
GTGCATGGCATATTGACGGAATTACAGCAACAAGGTTTTGCTGATGGTCAGTTTTGTTATCAGGCACGGG
TTGAACCGTGGCTCAAAATGTTGACGTTAACCAGTAACCTGCGTGTTTATCAGCGTATCAGTGTGCCGGA
TATGGTGTGCGATATTTTCCGTAAACGTGGGTTCAACGATGTTGAACTGGCGTTAAAAAGCCGTTATCCG
AAACTTGAATATTGCATGCAATACAAGGAATCAGATTTTGATTTTGTGACGCGCCAACTGGAACAAGCGG
GTATTTTCTACTTTTTTCGCCATGAAGAAGGGCGTCATGTGTTGGTACTGGCTGATCACCCTTCGACGTT
TGTTAACGCGCCTTTGGCGGTATTGCCGTATCAGTCGAAGCTCGGTAGTCAGCAAGGATACGGGCTGCGT
GCCTGGCAGATTCATCGCACGATGATCCCTGGCATGGCGGAAATGAGTGGCTATAACGTTAAAAATGCCT
CGACAGTCAGCGCCAGTGCTAAAGCGAATAGCGGTTATTCCATCAATCCGAAACTTTCTATCTATGACGA
TCGGCGTCAGGAGGAACGTAATCAGTTGGAGGCACAGGCGGCGCTGTGCATGGAACAGTGGGAATCACAG
TCGCATTATGCAAATGCGGTTAATAGTTATCCCGGTTTGCAAGTTGGGCATCAATTTACGTTGAAAGGGC
ATGTCAGCGCTGATGGGCGTTATGCGGTGGGCAGCCAGCAATTAAAAGCGGAAAGTAACCTGGAGGAAGG
AGGATTGTTGTTTTCGTCGCAGGTGACGCTGTTTCCGGCGAATAAAACGTTCCGTCCACGTCCTTCAGTT
ACGCGGCCCTATATTGCTGGTGTGTTGTCTGCGTTGGTTGTGGGTGCGGCATCGGAGGAGATTCATACCG
ATGCACAAGGGCGTATCAAAATCCAATTTCATTGGGATAAAGAGCACAAAAAAAATGATGACAGCTCTTG
TTGGGTACGCGTGAGCCAGTTTTGGAATGGTGCAAAATTTGGTGCTCAATTTGTGCCACGTGTGGGTAGT
GAAGTGTTGGTGAGTTTTGTTGACGGCGATCCCGATAGCCCGCTAGTGACTGGAACGGTTTACAACGGCG
TGAAGATGCCACCGTTTGCGTTGCCGGGACAAAAAACACAAAGCGGTATTGCTACCCGCAGCAGCGCAAA
AGGTACGGTGGAGCAAGGGCATCAATTTTGTTTCGAAGATAAGAAAGGTGAAGAATTTATTTTGCTTCAT
TCACAAAAAGACCTACGTCTGAAAGTGAAAAATGATTTTTCAGCGAATATTGACCGTAATGCCTCGTGGG
AAATTGCAGAGAAGCGCGATACAAAAATTAAAAAAGGCAACGATACGTTAATTCTGGGTGAAGGCAATGC
TGTCACTGAGGTAAAAAAAGGCGATAAGAAGCAAACACTGGATCACGGCAATTTCACCACGACTGTCAGC
GCGGGCAGTTATTCGCTGGAGGTATCCAGAGGCAGCGCCAAAATTAACGCGGGACAACACTGCACTATTA
CGGCCAATCAGGGAATTGAGCTGAAAGTGGGTGCCAGTAAATTGTCGATTACTCCGGCGGGGATCACCAT
CAAAGCGCCATCTGTCACGGTAGAAGGATCAGGGAAACTGGCATTGAAGAGCAGTGGAGTGGCGGAATTA
ACGGGAACTACAGTCAAAGTACAGGGCAGTGCGATGGCACAGTTAAAAGGCGGCATTGTTCAGGTGGATG
CGACAGGTATTGCGATGGTGAAAGGGATCTTGACCAAGATTGGTTAA