SecReT6
Protein ID: 253989757
SecReT6 ID356
T6SS typei4b
Gene symbol-
Locus tagPAU_02277
StrainPhotorhabdus asymbiotica subsp. asymbiotica ATCC 43949
Repliconchromosome [GenBank: NC_012962] [Browse all T6SS(s) in this replicon]
Location [Strand]2581224..2582186 [-]
Producthypothetical protein
NoteTssG
UniProt IDB6VKX6
KEGG IDpay:PAU_02277
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 3.80E-77, Aligned region: 13..299
Protein Sequence: 320 a.a.     [Download]
>gi|253989757|ref|YP_003041113.1| hypothetical protein PAU_02277 [Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949]
MALENRIRLAGGRFYQNVRRLLKRCHYRRSSEAAVIPDDVVQFSSVLTLDAPESEVDALLPPQQEGEQYR
MAVYHFGLLGTFGALPLRYTEWLIDRRYRYGDESAQAFIDIFTHRLLSLRFQAWQKYRLFVNAELQSRRA
LPAVIPAVAGQFTTNEPQHIRPACVGLLATSVRSMMNLQHLLQREFNMPVSIQPFRGRWQYAEQMHCCCL
GRSLLGDNPMLGSAYWDIQSGFHIQLGPFAAQQSADFMPGNERYRRLTQWVWQFAGPLLSFSLELLVKHD
GQGNILNGSRRLGWDGCLGNTGDTHIQRVYLGECVGPYTV
 
Nucleotide Sequence: 963 bp     [Download]
>gi|253987483|ref|NC_012962.1|:c2582186-2581224 Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949 chromosome, complete genome
ATGGCTTTAGAAAATAGAATACGTCTGGCTGGGGGGCGCTTTTATCAGAATGTTCGTCGTCTGCTTAAAC
GCTGTCACTATCGGCGAAGTAGTGAGGCAGCAGTTATTCCTGATGATGTGGTGCAATTTAGTTCGGTCCT
CACACTGGATGCGCCGGAAAGTGAAGTGGACGCTTTGTTGCCACCGCAACAAGAGGGTGAGCAGTATCGC
ATGGCGGTATATCACTTTGGTTTGTTGGGAACATTTGGTGCACTGCCGTTGCGCTATACCGAATGGCTGA
TTGATCGGCGTTATCGTTATGGCGATGAATCAGCTCAAGCGTTTATTGATATTTTTACCCATCGTCTGCT
CAGTCTGCGTTTTCAGGCATGGCAGAAATACCGGTTATTTGTTAATGCTGAATTGCAAAGCCGTCGGGCG
TTACCTGCGGTCATTCCGGCAGTGGCTGGGCAATTTACGACGAATGAACCACAGCATATTCGTCCTGCCT
GCGTTGGCTTGTTGGCAACATCTGTTCGTTCAATGATGAACTTGCAACATCTGTTGCAGCGGGAATTCAA
CATGCCAGTCAGTATTCAGCCGTTTAGGGGACGTTGGCAATATGCAGAGCAAATGCACTGTTGTTGTCTG
GGCCGCAGTTTGCTGGGTGATAATCCGATGTTAGGTAGCGCTTATTGGGATATTCAGTCGGGATTTCATA
TTCAGTTAGGACCGTTTGCAGCCCAGCAGAGCGCCGATTTTATGCCAGGAAATGAACGATACCGCAGATT
GACGCAGTGGGTGTGGCAATTTGCCGGTCCGTTGCTCTCTTTCTCGTTGGAATTGCTAGTAAAGCACGAT
GGGCAGGGCAATATATTAAACGGCAGTCGTCGATTGGGATGGGATGGTTGTTTGGGGAATACCGGCGATA
CCCATATTCAACGTGTGTATCTGGGAGAATGTGTGGGTCCTTATACGGTTTGA