SecReT6
Protein ID: 253989758
SecReT6 ID356
T6SS typei4b
Gene symbol-
Locus tagPAU_02278
StrainPhotorhabdus asymbiotica subsp. asymbiotica ATCC 43949
Repliconchromosome [GenBank: NC_012962] [Browse all T6SS(s) in this replicon]
Location [Strand]2582177..2583988 [-]
Producthypothetical protein
NoteTssF
UniProt IDB6VKX5
KEGG IDpay:PAU_02278
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 6.40E-165, Aligned region: 9..599
Protein Sequence: 603 a.a.     [Download]
>gi|253989758|ref|YP_003041114.1| hypothetical protein PAU_02278 [Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949]
MMLLPQKILTYYNRELSYLRQYGAAFSQRFPKIAKRLGFAEGVSEDPHVERLVESFAFLTAKIHQRIDED
MPELNNAMLEVLAPQFLRQVPSVSLVQFQQDPLASGVTGVMTVARHTPLISQPVDDVACRFRTVYPLEML
PLDLTHTELMPDPYDRDFILTLNFTLWPGASFRARHIRLYLHGAPILAHSLYELLSAQVKQLECRLGEHV
FNMDNRDIQVVGFDPQDNLCADDLMINPTHHLFRDYFSFPERFLFLDIPLPDAGLITKLAGDLHYRFRLK
DCAALRRIERMSDKVDSETFRLNCVPVVNLFSHQAEPIIPLETEHEYLVQPDARRPQSMEVYTIDRVEIV
SRQQEQLSSRSVPPLFGIEHTQDGEQPLLLWQASPRPSLRHNETGMNMFIGFSDSSGEQLKPETDVVVLS
LTCTNRDMPRLLSNGHPDGDFESEVALPGVKILGLIRPRLPARPQPNCALNWRLVSQLNLNQMLLSGSQG
VQCLKETLELYNLHGDPAISRLIAQLQQVAIVPVSARLNPADPYSLARGLEVTLTFQTQAGEFVDFYLFC
SLLERFIAMYAPINSFTQTVTQLESVNNSMRRWPRRSGRLTWL
 
Nucleotide Sequence: 1812 bp     [Download]
>gi|253987483|ref|NC_012962.1|:c2583988-2582177 Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949 chromosome, complete genome
ATGATGTTATTACCGCAAAAAATACTGACTTATTATAACCGGGAGCTGAGTTATTTAAGGCAATATGGTG
CCGCTTTTTCTCAGCGTTTTCCTAAAATTGCCAAACGTCTTGGATTCGCGGAGGGCGTTTCAGAAGATCC
CCATGTAGAACGGTTAGTAGAATCTTTTGCTTTTCTGACGGCCAAGATTCATCAGCGTATTGATGAAGAT
ATGCCAGAGCTGAACAACGCCATGCTGGAAGTGTTGGCACCACAATTCTTACGCCAGGTTCCGTCAGTAT
CGTTGGTACAGTTTCAACAAGACCCGTTGGCATCGGGTGTGACTGGCGTGATGACGGTGGCACGACATAC
GCCGTTAATTTCTCAGCCGGTCGATGATGTGGCTTGCCGTTTCCGCACGGTATATCCGCTGGAAATGTTG
CCACTGGATTTAACCCACACGGAACTGATGCCAGATCCTTATGATCGGGATTTTATTTTAACTCTGAATT
TCACGTTGTGGCCGGGTGCCAGCTTTCGGGCGCGTCATATTCGGTTGTACTTACATGGTGCGCCGATACT
GGCCCATAGCTTATATGAGCTGTTGTCGGCGCAGGTAAAACAACTGGAATGTCGGCTGGGTGAGCACGTA
TTCAACATGGATAACCGAGATATTCAGGTCGTGGGTTTCGATCCGCAAGATAACCTGTGCGCTGATGATC
TGATGATAAATCCGACTCATCATCTGTTCCGCGATTATTTTAGTTTTCCTGAACGGTTCTTATTTCTGGA
CATTCCGTTACCTGATGCAGGTTTGATCACCAAATTAGCGGGAGATCTGCATTATCGTTTCCGGCTTAAG
GATTGTGCTGCGTTGCGTCGTATTGAGCGAATGAGCGATAAAGTTGATAGTGAAACTTTTCGGCTAAATT
GTGTCCCGGTAGTGAATCTATTTTCTCATCAGGCAGAGCCGATTATTCCGTTAGAAACTGAGCACGAATA
CCTAGTGCAACCGGATGCGCGTCGTCCACAAAGTATGGAAGTCTATACTATCGATAGAGTTGAGATTGTT
AGCCGTCAGCAAGAGCAATTGAGTTCTAGATCTGTACCGCCATTATTCGGTATTGAACATACACAAGATG
GCGAGCAACCTCTGTTGCTCTGGCAAGCATCACCACGCCCTTCACTCAGGCATAACGAAACGGGAATGAA
TATGTTTATCGGTTTTTCCGATAGCAGTGGTGAGCAATTAAAGCCAGAAACCGATGTGGTGGTATTGAGT
TTAACCTGTACTAATCGTGATATGCCGCGGCTGTTGAGCAATGGTCATCCCGATGGGGATTTTGAATCAG
AGGTTGCTTTACCGGGCGTAAAAATTCTGGGACTGATCCGTCCCCGGTTACCGGCGCGCCCACAACCGAA
TTGCGCATTGAACTGGCGTTTGGTGTCACAACTCAATCTGAACCAAATGTTACTGAGTGGCTCGCAAGGC
GTTCAATGCCTAAAAGAGACGCTAGAACTGTACAACTTGCATGGTGATCCGGCCATATCGCGGTTAATTG
CCCAACTACAACAGGTTGCCATTGTGCCTGTGAGTGCACGTCTGAATCCTGCTGATCCTTATTCTCTGGC
GCGTGGATTGGAAGTGACGTTGACATTCCAGACACAGGCGGGTGAGTTTGTCGATTTTTATCTTTTTTGC
AGCCTACTGGAACGTTTTATCGCTATGTATGCGCCGATTAACAGTTTCACGCAGACAGTGACTCAATTGG
AATCGGTTAATAATAGTATGCGTCGTTGGCCACGTCGTAGCGGGAGGCTGACATGGCTTTAG