SecReT6
Protein ID: 253989759
SecReT6 ID356
T6SS typei4b
Gene symbol-
Locus tagPAU_02279
StrainPhotorhabdus asymbiotica subsp. asymbiotica ATCC 43949
Repliconchromosome [GenBank: NC_012962] [Browse all T6SS(s) in this replicon]
Location [Strand]2583990..2584433 [-]
Producthypothetical protein
NoteTssE
UniProt IDB6VKX4
KEGG IDpay:PAU_02279
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 4.20E-16, Aligned region: 27..122
Protein Sequence: 147 a.a.     [Download]
>gi|253989759|ref|YP_003041115.1| hypothetical protein PAU_02279 [Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949]
MIQPSFLHRLKDDYPQNEERGVTFIWSRQEVVQSLMFDLNMLFSSRPISAVLPLFGELPKSVLNYGVSDV
ISVDISDDERIDALSNNIYQAISWFEPRLKNVVITLQKNTPENITFWVSGIFFNEQIVFSISWSSTAYTY
SISWDRS
 
Nucleotide Sequence: 444 bp     [Download]
>gi|253987483|ref|NC_012962.1|:c2584433-2583990 Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949 chromosome, complete genome
ATGATTCAGCCTTCATTTCTCCATCGCTTGAAAGATGATTATCCACAAAATGAAGAACGTGGAGTAACGT
TTATTTGGTCGCGTCAGGAAGTTGTGCAAAGCCTTATGTTCGATCTGAACATGTTATTTTCATCAAGACC
GATTTCCGCAGTTTTACCTTTATTTGGTGAGTTACCGAAATCCGTTTTAAATTATGGCGTTTCTGATGTT
ATTAGTGTTGATATTTCGGATGATGAGCGTATTGATGCACTGAGTAATAATATTTACCAGGCTATTTCCT
GGTTTGAACCACGCCTAAAAAATGTCGTTATTACATTACAGAAAAATACACCGGAGAATATTACTTTTTG
GGTGAGTGGAATTTTTTTCAACGAACAGATTGTGTTTTCTATCTCATGGAGCAGTACTGCTTATACCTAT
TCAATTTCATGGGACAGATCATAA