SecReT6
Protein ID: 253989760
SecReT6 ID356
T6SS typei4b
Gene symbol-
Locus tagPAU_02280
StrainPhotorhabdus asymbiotica subsp. asymbiotica ATCC 43949
Repliconchromosome [GenBank: NC_012962] [Browse all T6SS(s) in this replicon]
Location [Strand]2584491..2584985 [-]
Producthypothetical protein
NoteTssD
UniProt IDB6VKX3
KEGG IDpay:PAU_02280
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.10E-33, Aligned region: 6..139
Protein Sequence: 164 a.a.     [Download]
>gi|253989760|ref|YP_003041116.1| hypothetical protein PAU_02280 [Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949]
MSSSIFLQIDGIKGESTDSKHKDWIELEHVNFGAFNHARIADSGKRKITVGAADFRTIDCVKVMDISSVK
LLSAVAQGTAIKKVKLEICTIFKGEMHPYAEVEMDECIISDVHETCSRGGEFPQEQFSITYSKIKWTFTP
LSPDGTKGNKAGPEGWDLIENKKQ
 
Nucleotide Sequence: 495 bp     [Download]
>gi|253987483|ref|NC_012962.1|:c2584985-2584491 Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949 chromosome, complete genome
ATGAGTTCTTCAATTTTTTTGCAAATTGATGGTATTAAAGGTGAAAGTACCGACAGCAAACATAAAGACT
GGATTGAGCTGGAGCATGTGAATTTTGGCGCGTTCAACCACGCACGTATTGCAGACAGTGGTAAACGTAA
GATTACCGTTGGTGCAGCGGATTTCCGTACGATCGACTGTGTGAAGGTGATGGACATCAGTTCTGTCAAA
TTGTTGTCAGCAGTGGCACAGGGGACTGCGATTAAGAAAGTGAAATTGGAAATCTGTACGATTTTCAAAG
GGGAAATGCACCCTTACGCGGAGGTTGAAATGGATGAATGTATTATCTCTGATGTCCATGAAACTTGTTC
ACGTGGCGGTGAATTCCCACAAGAGCAGTTTTCCATTACCTATTCCAAAATTAAATGGACATTCACACCA
CTCAGTCCAGACGGCACCAAAGGCAACAAAGCAGGTCCAGAAGGCTGGGATCTTATCGAAAACAAGAAAC
AGTAA