SecReT6
Protein ID: 253989761
SecReT6 ID356
T6SS typei4b
Gene symbol-
Locus tagPAU_02281
StrainPhotorhabdus asymbiotica subsp. asymbiotica ATCC 43949
Repliconchromosome [GenBank: NC_012962] [Browse all T6SS(s) in this replicon]
Location [Strand]2585049..2586530 [-]
Producthypothetical protein
NoteTssC
UniProt IDB6VKX2
KEGG IDpay:PAU_02281
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 2.00E-183, Aligned region: 66..488
Protein Sequence: 493 a.a.     [Download]
>gi|253989761|ref|YP_003041117.1| hypothetical protein PAU_02281 [Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949]
MEQSVVEQQELQATEASGDFLDQIIDNTQAIRRETDRDRVKSQLDQFLSEVTAGSLVVSGDLVNSIEERI
AAIDALMSAQLSLVLHHPEFQRLESSWTGLKGLLDQSETDNTQIRMLNATKTDLIKDFKSASDFDQSMLF
KNIYEHEYGTFGGEPYSAFVGDFDFDNSPEDLYLLEQISHVAAAAHAPFISSANAGMLGLNDFGELPRPR
DLSKLFDTSDYLRWKRFRESDDSRYVGLTLPRVIGRLPYGAKTIPIEQFCFEEQMREGDSNSYLWINAAY
ALAGRMVAAFEQYGWCAAIRGVEGGGLVEALPTHHYSSVSGEKMLQCPTEVAISDRREKELAELGFIPLV
YYKGTDYAAFFSVQSPNKPRKYNSDLANANAKLSTQLQYIMTTSRFAHYLKMIVRDKVGSFMSRGECQTY
LQSWINQYIVGSDTVGAEIKASHPLREARVDVVEVPGSPGTYRAVAYLRPHFQLEGLSMSLRLVADLPPS
SAA
 
Nucleotide Sequence: 1482 bp     [Download]
>gi|253987483|ref|NC_012962.1|:c2586530-2585049 Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949 chromosome, complete genome
ATGGAACAGAGCGTTGTTGAACAGCAAGAATTGCAAGCAACGGAAGCCAGCGGCGATTTTCTTGATCAGA
TTATTGATAACACCCAGGCCATTCGTCGGGAAACGGATCGTGATCGGGTAAAAAGCCAACTCGACCAGTT
TTTATCAGAAGTGACTGCTGGCTCATTAGTGGTTTCTGGTGATCTGGTAAACAGCATTGAGGAGCGTATT
GCCGCGATTGACGCGTTGATGTCAGCTCAACTGAGTTTGGTACTGCATCATCCAGAATTCCAGCGTCTGG
AATCTTCCTGGACGGGGCTTAAAGGGTTACTCGATCAGAGTGAAACGGATAACACCCAGATTCGCATGTT
GAACGCGACAAAAACCGATTTAATTAAGGACTTTAAATCGGCTTCTGATTTCGATCAGTCAATGCTGTTT
AAAAATATTTATGAACATGAGTACGGTACCTTTGGTGGTGAACCTTACTCGGCATTTGTGGGTGATTTTG
ATTTTGATAACAGCCCAGAAGATCTTTACTTACTGGAGCAGATTTCTCATGTGGCGGCTGCGGCACATGC
ACCGTTTATTAGTTCAGCCAATGCAGGCATGTTGGGGCTGAATGATTTTGGTGAATTACCGCGTCCGCGT
GATTTGTCCAAACTGTTTGACACATCCGACTATTTGCGTTGGAAACGCTTCCGGGAATCTGATGACTCCC
GTTATGTTGGTCTGACTTTGCCAAGAGTGATTGGTCGTTTGCCTTACGGAGCAAAAACGATTCCGATTGA
ACAGTTCTGTTTCGAAGAACAGATGAGAGAAGGGGATAGCAATAGTTATCTGTGGATTAATGCCGCTTAT
GCATTGGCTGGCCGTATGGTGGCTGCGTTTGAACAATATGGCTGGTGTGCTGCGATTCGTGGTGTAGAAG
GTGGGGGATTGGTCGAGGCATTGCCAACTCATCATTACTCCTCTGTGTCCGGCGAAAAAATGCTGCAATG
TCCAACTGAAGTGGCTATTTCTGATCGCCGTGAGAAAGAGTTGGCAGAATTAGGCTTTATTCCTCTGGTT
TATTATAAAGGGACTGACTACGCCGCATTTTTCTCTGTGCAGTCACCTAATAAACCCAGGAAATATAATT
CTGACCTGGCAAATGCCAATGCAAAATTATCAACACAATTGCAATATATTATGACGACTTCTCGCTTCGC
ACATTATTTGAAAATGATTGTGCGTGACAAAGTGGGTAGTTTTATGTCCCGCGGAGAATGCCAAACTTAT
CTGCAAAGTTGGATCAACCAATATATTGTTGGTTCTGATACTGTCGGCGCAGAAATTAAAGCCAGCCATC
CGTTGCGGGAGGCAAGAGTTGATGTTGTTGAAGTTCCCGGTTCACCTGGAACATATCGCGCAGTGGCTTA
TTTAAGGCCGCATTTCCAATTAGAGGGATTAAGCATGTCTTTACGGTTGGTTGCTGATTTACCACCGTCC
TCAGCTGCTTGA