SecReT6
Protein ID: 253989762
SecReT6 ID356
T6SS typei4b
Gene symbol-
Locus tagPAU_02282
StrainPhotorhabdus asymbiotica subsp. asymbiotica ATCC 43949
Repliconchromosome [GenBank: NC_012962] [Browse all T6SS(s) in this replicon]
Location [Strand]2586538..2587089 [-]
Producthypothetical protein
NoteTssB
UniProt IDB6VKX1
KEGG IDpay:PAU_02282
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.40E-48, Aligned region: 7..147
Protein Sequence: 183 a.a.     [Download]
>gi|253989762|ref|YP_003041118.1| hypothetical protein PAU_02282 [Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949]
MNTQRKLDKVRPPRVQITYDVELGGAVEKKELPLVIGVIGQFAEQSIPMRERRFMHVDKDNFNAVMEGLS
PSLELQVESALPDQSGFINIDLQFQSMADFSPENLAKQIEPLRNLLEIRSKLSDLKGRALSNEKLRDRLA
EILAEHADKLPPVNEEAETVATENTTDDVTPENNNIPEDNNAQ
 
Nucleotide Sequence: 552 bp     [Download]
>gi|253987483|ref|NC_012962.1|:c2587089-2586538 Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949 chromosome, complete genome
ATGAATACTCAACGTAAGCTTGATAAAGTAAGGCCGCCCCGTGTTCAGATTACTTATGATGTCGAATTAG
GTGGTGCGGTTGAGAAAAAAGAATTGCCTTTGGTTATTGGTGTGATTGGGCAATTTGCTGAGCAATCAAT
TCCTATGCGTGAACGTCGTTTTATGCATGTTGATAAAGATAATTTTAATGCTGTTATGGAAGGTTTATCA
CCTTCTTTGGAATTACAGGTTGAAAGTGCTCTGCCGGATCAGAGTGGATTTATTAATATCGATTTGCAAT
TTCAATCAATGGCTGATTTTTCCCCGGAGAATTTGGCGAAGCAGATTGAGCCACTTCGTAATTTATTGGA
AATTCGCAGCAAATTAAGTGATTTGAAAGGTCGTGCATTGAGTAATGAAAAATTGCGTGACCGTCTGGCG
GAAATTCTTGCTGAACATGCGGACAAATTACCGCCGGTAAACGAGGAAGCAGAAACCGTTGCAACAGAAA
ATACAACGGATGACGTTACCCCGGAAAATAACAATATTCCGGAAGATAACAATGCACAGTGA