SecReT6
Protein ID: 253990513
SecReT6 ID357
T6SS typei2
Gene symbol-
Locus tagPAU_03039
StrainPhotorhabdus asymbiotica subsp. asymbiotica ATCC 43949
Repliconchromosome [GenBank: NC_012962] [Browse all T6SS(s) in this replicon]
Location [Strand]3575095..3576147 [-]
Producthypothetical protein
NoteTssG
UniProt IDB6VN00
KEGG IDpay:PAU_03039
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 7.10E-78, Aligned region: 6..309
Protein Sequence: 350 a.a.     [Download]
>gi|253990513|ref|YP_003041869.1| hypothetical protein PAU_03039 [Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949]
MAALKANISTLDFYSFCQIIERAVPDGPPLGSTANPADDAIRFRPHPGMGFPVSELKALVTDREHPERPP
TARTTFLGLYGVDSPLPTAYLDDIAQRREGYDAMETFLDIFNHRIFTQFYRIWRKYSSYPATFAAGGTDG
TSQCLLGLIGLGISGSRQNIATPMSRFLALLSVMRLPTRTAEGISALVALLAPRTRTVVTACCRRQVHLT
HPAEFSDTHPVSLSQRTVLGRTGTDINSQLLVALHTDCPEEARGWLPGGQLHTDFQVLLRVYLGWRYLAR
LQLTLPTRILPPPVLGGMPVQLGLTGVLGLKVESHPTTVPDNITVNLGNYQGITVDSNENKEGRYVNYRF
 
Nucleotide Sequence: 1053 bp     [Download]
>gi|253987483|ref|NC_012962.1|:c3576147-3575095 Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949 chromosome, complete genome
ATGGCCGCCCTGAAGGCCAATATATCGACACTCGATTTTTATTCATTCTGTCAGATAATTGAACGGGCCG
TTCCCGACGGGCCCCCTTTGGGGAGTACAGCGAATCCTGCCGATGATGCGATACGTTTCCGGCCTCATCC
GGGCATGGGCTTCCCGGTCAGTGAGTTGAAAGCGTTGGTAACTGACCGCGAACACCCGGAACGCCCACCG
ACGGCCAGAACTACATTTCTTGGTTTGTACGGGGTGGATTCACCGCTGCCGACCGCTTATCTGGATGATA
TTGCCCAGCGTCGGGAAGGGTATGACGCGATGGAAACCTTTCTGGATATCTTTAACCACCGGATATTCAC
CCAGTTTTACCGTATCTGGCGTAAATATTCTTCCTATCCCGCCACGTTTGCAGCCGGGGGAACGGATGGG
ACATCTCAGTGTTTACTGGGGCTGATTGGTTTAGGTATATCGGGCAGCCGACAGAATATAGCCACGCCGA
TGTCCCGTTTTCTGGCGTTACTTAGCGTTATGCGTCTGCCGACCCGTACCGCTGAAGGTATCTCTGCGCT
GGTCGCGTTGTTGGCACCGCGGACCCGAACGGTGGTGACTGCCTGTTGTCGCCGGCAAGTCCACCTGACG
CACCCAGCAGAGTTTTCAGATACGCATCCGGTTTCTCTGTCGCAGCGTACCGTGCTGGGCAGAACGGGCA
CTGATATTAACAGTCAGCTATTAGTGGCATTGCATACGGATTGCCCGGAAGAAGCGCGAGGTTGGCTGCC
GGGCGGGCAGTTGCACACGGATTTTCAGGTGTTGTTGCGGGTTTATCTTGGCTGGCGTTACCTGGCTAGA
TTACAACTGACCTTGCCGACCCGGATACTACCGCCACCAGTGTTGGGTGGTATGCCTGTTCAGCTGGGGC
TAACCGGGGTCTTAGGGCTTAAGGTTGAAAGTCATCCAACGACAGTACCTGACAATATCACCGTGAATTT
GGGGAATTATCAAGGCATTACGGTAGATAGTAATGAAAACAAAGAAGGACGTTATGTCAACTATCGATTT
TAA