SecReT6
Protein ID: 253990514
SecReT6 ID357
T6SS typei2
Gene symbol-
Locus tagPAU_03040
StrainPhotorhabdus asymbiotica subsp. asymbiotica ATCC 43949
Repliconchromosome [GenBank: NC_012962] [Browse all T6SS(s) in this replicon]
Location [Strand]3576147..3578030 [-]
Producthypothetical protein
NoteTssF
UniProt IDB6VMZ9
KEGG IDpay:PAU_03040
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 2.90E-185, Aligned region: 46..620
Protein Sequence: 627 a.a.     [Download]
>gi|253990514|ref|YP_003041870.1| hypothetical protein PAU_03040 [Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949]
MWLMLLVESAKIIFLLKMFYHFSVRAEPVTLFFDNHENNPMDDLTLRYYEAEMRYLREAGKEFAEAYPDR
AAMLNLDKVGIRDPYVERLLEGFAFLMGRLREKLDDDLPELTEGLVSLLWPHYLRTIPSLSIIELNPDWA
QMKKSVPVQKGFEVLSQPIGPHRTRCRYTTTQAVQLLPLALTVASLQAEPDGRSVIRLRFDCGTLVDWRQ
VDLRRLPLYLSADSPLACALHQAFTLQTQQLYLRLPGQPDRQPFAGGFSPLGFGDTERLWPKGESAFSGY
QLLLEYFTFREKFMFVALCGLETLTIPESTPWFELDVVLGESWPGDLPFSAEHIRLHCTPVINLFPLESD
PLRLSPLQTEYLLRPMRVQDGHTEIYSVDAVVSSERGGQQGYVPFSSFRHKGGMMRHDAPERYYHTRVKR
GPSGLYDTWLILGGEDFDDDKPYEEENLSLTLTGTNGQLPRQALQDTLLDTPVNPPLAGLTVRNLCEPTL
PCYPPNQDRFHWRILSHLGSNFLSMMDNPEVLRGTLALYDWADNEMNARRLAAIVAVKHSLIERFEQGCL
RRGVHIEVTLDRNGFSGTGDICLFGEMLSRFFALYTDIHLFNRLTLILQPTGERLLWEELHCPHIPG
 
Nucleotide Sequence: 1884 bp     [Download]
>gi|253987483|ref|NC_012962.1|:c3578030-3576147 Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949 chromosome, complete genome
ATGTGGCTGATGTTACTGGTCGAGTCGGCCAAGATCATATTCCTTCTTAAGATGTTTTATCACTTTTCGG
TTCGAGCAGAACCGGTAACTCTATTTTTTGACAACCATGAGAACAATCCTATGGATGATTTAACCCTGCG
CTATTATGAGGCAGAAATGCGCTACTTGCGTGAAGCAGGTAAAGAGTTTGCTGAGGCTTACCCTGATCGG
GCTGCGATGCTGAATCTGGATAAGGTTGGCATCCGTGACCCCTATGTAGAACGTTTGCTTGAAGGCTTTG
CCTTTTTGATGGGGCGTTTACGCGAGAAACTGGATGATGACCTCCCAGAGTTGACGGAAGGGCTGGTTAG
TCTGTTGTGGCCGCATTACTTGCGTACTATTCCTTCGCTGTCGATTATTGAACTGAACCCGGATTGGGCA
CAGATGAAAAAGTCAGTGCCGGTGCAAAAGGGGTTTGAGGTGCTATCGCAGCCGATTGGCCCACACCGGA
CCCGCTGCCGTTATACCACAACTCAGGCTGTTCAACTGTTGCCGTTGGCGCTGACAGTTGCCTCGCTACA
GGCTGAACCGGACGGGCGTTCTGTTATCCGCCTGCGTTTTGATTGTGGGACGCTGGTAGACTGGCGCCAA
GTTGATTTACGCCGTTTGCCGCTATACCTGAGTGCCGATAGTCCGCTAGCCTGTGCATTGCATCAGGCAT
TCACGCTTCAGACACAACAACTTTATCTGCGTTTGCCGGGCCAGCCTGACCGCCAGCCATTTGCCGGTGG
ATTCTCGCCGTTGGGATTTGGGGATACGGAGAGGTTATGGCCGAAAGGGGAAAGTGCGTTCAGTGGCTAT
CAATTGCTATTGGAATATTTTACTTTTCGGGAAAAATTTATGTTTGTGGCGCTCTGTGGGTTGGAAACAC
TGACTATCCCTGAGAGTACGCCGTGGTTTGAGTTGGATGTGGTACTGGGTGAAAGCTGGCCCGGTGATCT
GCCGTTTTCGGCGGAACATATCCGTTTGCACTGTACACCGGTGATTAACCTGTTTCCGCTGGAATCCGAC
CCGCTGCGATTGTCCCCGTTGCAAACCGAGTATTTGCTGCGTCCGATGCGTGTTCAAGACGGACACACTG
AGATTTATTCGGTGGATGCGGTGGTCTCTTCGGAACGCGGCGGTCAACAGGGGTATGTGCCGTTCAGTAG
TTTCCGTCATAAAGGCGGTATGATGCGGCATGATGCGCCGGAGCGTTATTACCATACGCGGGTAAAACGG
GGACCATCAGGTTTATATGACACCTGGCTGATTCTGGGCGGGGAGGATTTTGATGATGATAAACCATATG
AAGAGGAAAACTTATCACTGACACTGACCGGCACCAACGGGCAACTCCCTCGTCAGGCCTTGCAGGATAC
GTTACTGGATACGCCGGTTAATCCCCCATTGGCGGGTCTGACTGTGCGTAATTTGTGTGAACCGACGCTG
CCTTGTTATCCGCCGAATCAGGATCGCTTCCATTGGCGGATACTCAGTCATCTTGGCTCCAACTTTCTCA
GTATGATGGACAACCCGGAAGTGTTGCGCGGCACGTTGGCTTTGTATGACTGGGCTGACAATGAGATGAA
CGCTCGCCGTCTTGCGGCGATTGTGGCGGTGAAACATTCGCTTATCGAGCGGTTCGAGCAGGGGTGTCTG
CGCCGAGGGGTACACATTGAAGTGACCTTGGATCGCAATGGGTTTTCCGGTACCGGTGATATCTGCCTGT
TTGGAGAAATGCTCAGCCGTTTCTTTGCTCTCTACACCGATATTCATCTGTTTAACCGGCTCACTTTAAT
TTTGCAACCTACGGGGGAACGACTGTTATGGGAAGAACTCCACTGTCCGCACATTCCCGGCTGA