SecReT6
Protein ID: 253990522
SecReT6 ID357
T6SS typei2
Gene symbolvgrG4
Locus tagPAU_03048
StrainPhotorhabdus asymbiotica subsp. asymbiotica ATCC 43949
Repliconchromosome [GenBank: NC_012962] [Browse all T6SS(s) in this replicon]
Location [Strand]3587172..3589571 [-]
Producthypothetical protein
NoteTssI
UniProt IDB6VMZ1
KEGG IDpay:PAU_03048
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 2.50E-60, Aligned region: 34..361
DUF2345 [PF10106], Evalue: 1.50E-39, Aligned region: 621..767
T6SS_Vgr [PF13296], Evalue: 4.40E-36, Aligned region: 494..597
Phage_base_V [PF04717], Evalue: 4.10E-20, Aligned region: 407..488
Protein Sequence: 799 a.a.     [Download]
>gi|253990522|ref|YP_003041878.1| hypothetical protein PAU_03048 [Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949]
MTVSTPALIFEHSRYKLDVRKNTAPLDILAFTGREALSQPFCYTIEFTSPVKTIEPGQMLMHKAAFTLHS
PRVNPGIRGMPIIPPMPLRTLYGVISRFRLLSTSHDESRYEVTLVPRLALLANSHQSAIYQNMSVPEIVE
KILRERHGFRGQDFLFTLARTYPKREQVMQYGEDDLRFVQRLLAEVGIWYKLTADERLKIDVVEFYDKQR
HYQFNVYLPALDPSGMHGRDTDAVWGMETAHQVVEGKILTRDYNYRDAQPQYGMDVEADVTRGDPTVYGE
AYHYINHYRVLGNRYAIEPEAESGVFYARLHHERYLNQQTRLRGLTTSATLVPGQELKVQGEAPEVFRQG
VIITEITSSARRDASFVMAFTAIPYSETVCFRPALIPKPVMAGTLPARVSSTTVNDRYGDIDKDGLYRVS
FDFDRATWPQGGESLWVRLARPYAGDTYGFHWPLLIGTEVAIAFEGGDPDRPYIAHALHDSKHPDPVTLY
NYKRNVLRTPANNKLRMDDERGKEHIKLSTEYGGKSQLNLGHLVDSQRPHPNKRGEGFELRTDDWGAIRA
GKGLFISADKQATAGGPVLEMQAAISLVKGAVNQVMEWGTLTQTHLNPQPDTDSLKAYLQSADGLKTAAM
LLSAPEGIGVVSPQTVMVHSGQALYAQSAGDVHIASACRIGMNATQAISLLAQTEGMRLVSGKGPLTMES
HGDVLGLTALKDVTVKSTQGQVQVIAKNGLTLACGGAYIRLTPAGEIEIHGPGLLSLKGQHKMDAPAKQD
FPLPDLPESVCKECLKKAQEMAQGFVLRK
 
Nucleotide Sequence: 2400 bp     [Download]
>gi|253987483|ref|NC_012962.1|:c3589571-3587172 Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949 chromosome, complete genome
ATGACTGTTTCAACCCCGGCGCTTATCTTTGAGCACAGTCGCTACAAACTCGATGTGCGGAAGAACACCG
CGCCGCTGGATATCCTGGCCTTTACCGGACGGGAAGCGTTAAGCCAGCCTTTTTGTTACACCATTGAATT
CACCAGCCCGGTGAAAACGATTGAGCCGGGGCAGATGCTGATGCATAAAGCGGCGTTTACCCTGCACTCG
CCGCGGGTGAATCCCGGTATCCGGGGCATGCCGATAATCCCGCCCATGCCATTGCGTACCCTTTACGGTG
TGATTAGCCGTTTCAGATTGCTGTCTACCTCGCATGACGAAAGCCGGTATGAAGTGACACTGGTGCCCCG
GCTGGCGCTGTTGGCGAACAGTCATCAGTCGGCGATTTACCAGAATATGTCGGTGCCAGAAATCGTAGAA
AAAATCCTGCGGGAGCGGCACGGCTTCCGGGGACAGGATTTTCTGTTCACGCTGGCGCGCACTTACCCGA
AGCGGGAGCAGGTGATGCAGTACGGCGAGGATGACCTGCGATTTGTGCAGCGGCTGCTGGCGGAAGTGGG
TATCTGGTACAAACTGACGGCGGACGAACGGCTGAAAATTGACGTGGTGGAGTTTTACGACAAACAGCGT
CACTACCAGTTTAACGTCTACCTGCCGGCCCTGGACCCGTCAGGCATGCATGGCCGGGACACAGATGCGG
TGTGGGGTATGGAAACCGCGCATCAGGTAGTGGAAGGGAAAATCTTGACCCGGGATTACAACTACCGCGA
CGCGCAACCGCAATACGGGATGGATGTGGAGGCGGATGTGACGCGGGGAGACCCGACGGTTTACGGGGAA
GCGTACCATTACATCAATCACTACCGGGTGCTGGGAAACCGTTACGCCATTGAACCGGAAGCGGAAAGCG
GGGTGTTTTATGCCCGGCTGCACCATGAGCGCTACCTGAATCAACAGACCCGGCTGCGGGGATTAACCAC
CTCGGCCACGCTGGTACCGGGGCAGGAGTTGAAAGTGCAGGGTGAGGCCCCTGAAGTGTTTCGTCAAGGG
GTGATTATCACCGAGATAACCAGCAGCGCCCGCCGGGATGCAAGTTTTGTCATGGCGTTTACCGCCATCC
CCTATTCAGAAACCGTGTGTTTTCGTCCGGCATTAATTCCGAAGCCGGTGATGGCGGGCACGCTGCCGGC
GCGGGTAAGCAGTACCACCGTGAATGACCGGTACGGGGATATCGACAAAGACGGGTTGTATCGGGTGTCA
TTTGACTTTGACCGGGCGACTTGGCCGCAGGGGGGGGAGAGCCTGTGGGTGCGATTAGCCCGGCCCTACG
CGGGTGACACCTACGGTTTTCACTGGCCGTTGCTGATTGGCACGGAAGTGGCGATTGCGTTTGAAGGGGG
CGACCCGGACCGGCCTTATATTGCTCACGCACTGCATGACTCGAAACACCCCGACCCCGTCACGCTGTAC
AACTACAAACGTAACGTCCTGCGCACGCCGGCGAATAACAAATTGCGGATGGATGACGAGCGCGGGAAGG
AGCACATCAAACTCAGTACTGAATACGGTGGCAAGAGCCAGCTCAATCTGGGGCATCTGGTGGACAGCCA
GCGTCCACACCCGAATAAACGGGGCGAAGGCTTTGAGCTGCGTACCGATGACTGGGGCGCAATCCGCGCC
GGTAAGGGGTTGTTTATCAGTGCGGATAAACAAGCCACTGCCGGGGGACCGGTGCTGGAGATGCAGGCGG
CAATTAGTCTGGTCAAAGGGGCGGTGAATCAGGTGATGGAATGGGGCACGCTCACCCAAACCCATCTGAA
TCCTCAGCCGGATACCGACAGCCTTAAGGCTTATCTACAGAGTGCGGATGGTCTAAAAACGGCGGCGATG
CTGTTGAGTGCACCAGAGGGTATCGGGGTTGTCAGTCCGCAGACTGTGATGGTGCACAGTGGTCAGGCGC
TCTATGCCCAAAGTGCGGGCGATGTGCATATTGCCAGTGCCTGTCGCATTGGAATGAATGCCACTCAGGC
CATCTCTTTGCTGGCGCAAACCGAGGGCATGCGTCTGGTCTCGGGGAAAGGGCCGCTCACGATGGAATCC
CACGGGGATGTGTTAGGTCTCACCGCGTTAAAGGATGTCACCGTCAAGTCAACGCAGGGGCAAGTACAGG
TTATCGCTAAAAATGGCCTGACACTGGCGTGTGGGGGCGCGTATATCCGTCTTACTCCGGCAGGAGAAAT
TGAAATTCATGGGCCTGGCCTGCTAAGCCTGAAAGGGCAGCACAAAATGGACGCCCCGGCAAAACAGGAT
TTTCCGTTACCTGACCTGCCGGAATCTGTGTGTAAAGAGTGCTTAAAAAAAGCGCAGGAGATGGCACAAG
GGTTTGTTTTGAGGAAATAA