SecReT6
Protein ID: 253990524
SecReT6 ID357
T6SS typei2
Gene symbol-
Locus tagPAU_03050
StrainPhotorhabdus asymbiotica subsp. asymbiotica ATCC 43949
Repliconchromosome [GenBank: NC_012962] [Browse all T6SS(s) in this replicon]
Location [Strand]3589955..3590446 [-]
Producthypothetical protein
NoteTssD
UniProt IDB6VMY9
KEGG IDpay:PAU_03050
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 5.20E-36, Aligned region: 6..147
Protein Sequence: 163 a.a.     [Download]
>gi|253990524|ref|YP_003041880.1| hypothetical protein PAU_03050 [Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949]
MAIPAYLWLKDDGGADIKGSVDVQNREGSIEIVALEHALHIPTDNNTGKLTGTRVHAPLVFTKEVDASTP
YLYKAVTSGQTLKSAEIKWYTIDDAGQEKEYFNTRLDNVKVVKVAPLMHDIKDPAKEKHNHLEQIEFRYE
KITWTYKDGNIIHSDAWNERNQA
 
Nucleotide Sequence: 492 bp     [Download]
>gi|253987483|ref|NC_012962.1|:c3590446-3589955 Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949 chromosome, complete genome
ATGGCTATCCCCGCTTATTTGTGGTTGAAAGATGACGGTGGTGCGGACATCAAAGGTTCTGTCGATGTAC
AGAACCGTGAAGGCAGCATCGAAATTGTGGCGTTGGAACATGCATTGCATATTCCGACGGACAACAATAC
TGGCAAGCTGACCGGAACCCGCGTGCACGCCCCGCTAGTGTTCACGAAAGAAGTCGATGCTTCAACCCCT
TATTTGTATAAAGCGGTCACCTCTGGCCAAACCCTGAAATCCGCAGAAATCAAGTGGTACACAATTGATG
ATGCGGGTCAGGAGAAAGAATATTTCAACACCCGACTGGACAACGTGAAGGTGGTGAAAGTGGCGCCGCT
GATGCATGACATCAAAGATCCTGCCAAAGAGAAACACAACCATCTGGAACAAATTGAGTTCCGCTACGAA
AAAATCACCTGGACGTACAAAGACGGCAACATCATTCACTCGGATGCGTGGAATGAGCGTAATCAGGCGT
AA