SecReT6
Protein ID: 253990533
SecReT6 ID357
T6SS typei2
Gene symbol-
Locus tagPAU_03059
StrainPhotorhabdus asymbiotica subsp. asymbiotica ATCC 43949
Repliconchromosome [GenBank: NC_012962] [Browse all T6SS(s) in this replicon]
Location [Strand]3597927..3599276 [-]
Producthypothetical protein
NoteTssK
UniProt IDB6VMY0
KEGG IDpay:PAU_03059
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 2.50E-133, Aligned region: 18..446
DUF2017 [PF09438], Evalue: 0.0076, Aligned region: 312..353
Protein Sequence: 449 a.a.     [Download]
>gi|253990533|ref|YP_003041889.1| hypothetical protein PAU_03059 [Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949]
MKIDRPLWVTGTILSPQQFQQQARWEAYTNDRIARLGWVHPWGVQTAGFDKDALSLGQLKADHLCVRFAD
GSLIDTDQADRLPPVLTLAAVLPADTQQVTVLLALPHTYANGGNCLKPDEQADRPVRYRQEWVSVQDEFG
DCSESMAAARYALSLRFDSMENGQYLTCPVARLLRDAQGNWAFDTQFVPPLLRVGANAELINRLDRLLTQ
LRAKQARLMGMRRESNERMADFAVADVSLFWLLNALNSYEPVLSDFLLHADVHPELFYREMVKLVGSLLT
FSLDHDAGVIPRYQHDNLTVVFPPLFDLLSQLLETSLPSRMVAIELRKQGEQQWLGTLHDARLCEAADFY
LSVRSSMPAHQLQTRFPLLCKAGAPDDVDRMINRALTGIPLVALSHVPAAVPLRLENQYFAFDLSHPAAK
AMLAAGTCAFYVPSILGEIQLELFAVLRT
 
Nucleotide Sequence: 1350 bp     [Download]
>gi|253987483|ref|NC_012962.1|:c3599276-3597927 Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949 chromosome, complete genome
ATGAAAATTGATCGTCCGCTCTGGGTGACGGGGACCATTTTGTCGCCACAACAGTTTCAGCAGCAGGCCC
GTTGGGAAGCTTACACTAACGATCGTATTGCCCGTCTGGGGTGGGTGCATCCTTGGGGTGTGCAAACGGC
TGGGTTTGATAAAGATGCTCTGTCGCTGGGACAGCTGAAGGCCGATCACCTGTGTGTACGTTTTGCTGAT
GGATCGTTGATTGATACCGATCAGGCTGACAGGTTACCGCCGGTACTAACATTGGCGGCGGTCCTGCCAG
CTGATACGCAACAGGTTACCGTGTTGTTGGCACTGCCGCACACTTATGCTAATGGAGGCAATTGTCTTAA
GCCAGATGAACAGGCTGACCGTCCGGTACGTTACCGGCAGGAATGGGTGTCGGTACAGGATGAATTCGGT
GACTGTAGTGAATCGATGGCAGCGGCTCGTTATGCCCTGTCGCTACGTTTTGACAGCATGGAAAATGGAC
AATATCTCACCTGCCCGGTCGCTCGTCTGTTGCGTGACGCTCAGGGTAACTGGGCCTTTGATACGCAGTT
TGTGCCGCCATTACTGCGTGTCGGGGCGAATGCCGAACTGATAAATCGGCTTGATCGGTTGCTGACCCAG
CTAAGGGCCAAACAGGCTCGCTTGATGGGAATGCGCCGTGAGAGTAACGAACGGATGGCGGATTTTGCCG
TGGCGGATGTCTCATTATTTTGGTTGCTCAATGCGCTGAACAGTTATGAACCGGTGCTGAGTGATTTTCT
GCTCCACGCGGATGTGCATCCGGAGCTGTTCTACCGTGAAATGGTCAAATTGGTTGGCAGTCTGTTGACC
TTTTCGCTGGACCATGATGCTGGAGTGATCCCTCGTTATCAGCACGATAACCTGACCGTAGTGTTTCCCC
CGTTGTTTGACTTGCTGAGCCAATTGCTGGAAACCAGCTTGCCATCGCGCATGGTGGCGATTGAGCTGAG
AAAACAGGGAGAACAGCAATGGCTGGGAACCTTGCATGATGCTCGCTTGTGCGAAGCGGCAGATTTTTAT
CTTTCGGTCCGCTCATCAATGCCAGCCCATCAATTGCAAACTCGGTTTCCTCTATTGTGTAAAGCCGGTG
CGCCGGATGATGTTGATCGGATGATTAACCGGGCACTGACCGGAATCCCGCTGGTGGCATTAAGCCATGT
GCCGGCGGCGGTTCCGTTGCGGCTGGAAAACCAATATTTTGCTTTCGATCTGAGCCATCCGGCGGCTAAA
GCGATGCTGGCGGCAGGAACCTGCGCCTTTTACGTGCCCAGTATCTTGGGTGAGATTCAACTTGAACTGT
TTGCGGTACTGCGGACATGA