SecReT6
Protein ID: 253990534
SecReT6 ID357
T6SS typei2
Gene symbol-
Locus tagPAU_03060
StrainPhotorhabdus asymbiotica subsp. asymbiotica ATCC 43949
Repliconchromosome [GenBank: NC_012962] [Browse all T6SS(s) in this replicon]
Location [Strand]3599289..3600821 [-]
Producthypothetical protein
NoteTssC
UniProt IDB6VMX9
KEGG IDpay:PAU_03060
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 4.60E-176, Aligned region: 85..506
Protein Sequence: 510 a.a.     [Download]
>gi|253990534|ref|YP_003041890.1| hypothetical protein PAU_03060 [Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949]
MAVQEQMTSAVATTTHGQGGIYQSLFEKIHLQPVERLSDIDRFQNNDALADVTADERVTAAVSVFLTLLK
ESAQKVKRLDKTLLDQHIDALDSQISRQLDVVMHHPAFQQVEAAWRGLKFLVDRTDFRQNVKIEVLDVTK
DDLRQDFDDAPEIVQSGFYCHTYIEEYDTPGGEPIGSVIANYEFDAGSQDIALLRNIAKVAAAAHMPFIA
SAGPAFFGKETMEEVASIKDIGSYFDRAEYIKWKSFRDSDDARYIGLTLPRVLGRLPYGPDTVPVRTFNY
IEHVKGPDHNKYLWTNAAFAFAANMVKSFVGNGWCVQIRGPQAGGAVPDLPIHLYDLGTGSQVKIPSEVM
IPETREFEFANLGFIPLSYYKNRDYACFFSANSTQKPALYDTNEATANSRINARLPYIFLLSRIAHYLKL
IQRENIGTTKDRRLLEVELNNWINTLVTEMTDPSDDLQASHPLREARVIVEDIDDNPGFFRVKLYTVPHF
QVEGLDVNLSLVSQMPKAKG
 
Nucleotide Sequence: 1533 bp     [Download]
>gi|253987483|ref|NC_012962.1|:c3600821-3599289 Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949 chromosome, complete genome
ATGGCGGTACAAGAACAGATGACATCTGCTGTGGCGACGACGACCCACGGTCAAGGTGGCATTTATCAAT
CTTTATTTGAAAAAATCCATTTACAGCCAGTTGAACGACTGAGTGATATCGACCGTTTTCAGAATAACGA
TGCACTGGCCGATGTGACGGCGGATGAGCGGGTCACCGCGGCGGTCAGCGTTTTTCTCACACTGTTGAAA
GAGTCAGCGCAAAAAGTTAAGCGGCTGGATAAAACGTTGCTGGATCAGCATATCGATGCACTGGATAGTC
AAATTAGTCGTCAACTGGATGTTGTCATGCATCATCCGGCATTCCAACAGGTGGAAGCGGCTTGGCGGGG
CCTGAAATTTCTGGTTGACCGGACGGATTTCCGTCAGAACGTCAAAATTGAAGTGCTGGATGTGACTAAG
GACGATTTGCGGCAAGATTTTGATGATGCGCCGGAAATTGTTCAAAGTGGTTTCTATTGCCATACCTACA
TTGAGGAATACGATACCCCGGGCGGTGAACCTATCGGATCGGTGATTGCCAACTATGAATTTGATGCCGG
ATCGCAAGATATTGCTCTGTTGCGCAATATTGCTAAAGTGGCGGCAGCGGCGCATATGCCCTTTATCGCT
TCTGCTGGCCCGGCCTTTTTCGGCAAGGAAACTATGGAAGAGGTCGCGTCCATTAAAGACATTGGTAGCT
ACTTTGACCGCGCTGAATATATCAAATGGAAATCCTTCCGTGACAGCGACGATGCCCGTTATATCGGCTT
GACATTACCGAGGGTATTGGGGCGTCTGCCCTACGGCCCGGATACGGTACCGGTAAGAACCTTTAATTAC
ATCGAACACGTTAAAGGGCCGGACCACAATAAATATTTGTGGACCAATGCCGCTTTTGCCTTTGCCGCTA
ACATGGTGAAAAGCTTTGTCGGAAACGGTTGGTGTGTGCAAATCCGTGGGCCACAGGCGGGTGGGGCGGT
CCCTGATTTGCCAATCCACCTTTACGATTTAGGGACCGGTAGTCAGGTTAAAATTCCTTCAGAAGTGATG
ATCCCGGAAACCCGTGAGTTTGAATTTGCCAATTTGGGTTTTATTCCACTCTCTTACTATAAAAACCGCG
ATTACGCCTGCTTCTTCTCAGCTAACTCAACGCAAAAACCGGCATTATATGACACCAATGAAGCGACGGC
TAACAGCCGCATCAATGCGCGTCTGCCGTATATCTTCCTGTTGTCTCGCATTGCCCATTATCTAAAGTTG
ATCCAGCGGGAGAACATTGGCACCACTAAGGATCGACGTTTGCTGGAAGTTGAACTGAACAATTGGATCA
ACACGTTGGTGACAGAGATGACCGATCCGTCTGACGATTTGCAGGCATCCCATCCACTGCGTGAAGCACG
GGTAATCGTTGAGGATATTGACGACAATCCGGGATTTTTCCGGGTCAAGTTATATACGGTACCGCACTTC
CAAGTAGAAGGGCTTGACGTCAATCTGTCGCTGGTTTCTCAGATGCCAAAAGCGAAAGGCTAA