SecReT6
Protein ID: 253990535
SecReT6 ID357
T6SS typei2
Gene symbol-
Locus tagPAU_03061
StrainPhotorhabdus asymbiotica subsp. asymbiotica ATCC 43949
Repliconchromosome [GenBank: NC_012962] [Browse all T6SS(s) in this replicon]
Location [Strand]3600881..3601540 [-]
Producthypothetical protein
NoteTssB
UniProt IDB6VMX8
KEGG IDpay:PAU_03061
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 9.60E-56, Aligned region: 60..212
Protein Sequence: 219 a.a.     [Download]
>gi|253990535|ref|YP_003041891.1| hypothetical protein PAU_03061 [Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949]
MLLFIPVSNVGVLLFFTSWLTTCLEISESGFLFLKSVMACPSCLSFHFIIEEWLVAQSFQNEIPKARINI
KLDLHTGGAQKKVELPLKLLVMGDYSNGQEQRPLSEREKVSINKNNFDSVLAEFSPALNLTVENTLAGDG
SEANIALAFRQIKDFEPEQVARQIPHLRALLAMRNLLRDLKSNLLDNATFRRELEHILQDDQLSDELRAE
LAALAPQED
 
Nucleotide Sequence: 660 bp     [Download]
>gi|253987483|ref|NC_012962.1|:c3601540-3600881 Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949 chromosome, complete genome
ATGCTTTTATTTATCCCAGTGAGCAATGTCGGTGTTCTCTTATTTTTTACTTCTTGGTTGACGACCTGTC
TTGAAATATCTGAATCCGGTTTTCTATTTCTGAAATCTGTTATGGCATGTCCATCATGTCTTTCATTTCA
TTTTATTATTGAGGAGTGGCTTGTGGCACAAAGTTTTCAAAATGAGATCCCCAAAGCGCGTATTAATATC
AAATTAGATTTGCATACGGGCGGTGCACAGAAAAAAGTGGAATTGCCCCTGAAATTATTGGTGATGGGCG
ATTACAGCAACGGACAGGAACAACGTCCTCTTTCGGAAAGGGAAAAGGTTTCTATTAACAAAAACAATTT
TGACAGCGTACTGGCTGAATTCAGTCCAGCTCTTAACCTGACGGTTGAAAATACCCTGGCTGGTGACGGA
AGTGAGGCGAATATCGCGCTGGCTTTCCGGCAAATAAAAGACTTTGAACCTGAGCAGGTAGCTCGCCAAA
TTCCGCACCTGCGGGCGCTGCTTGCTATGCGCAATCTATTGCGCGACCTGAAATCCAACCTGCTCGACAA
TGCCACGTTTCGCCGCGAGCTGGAGCATATTCTCCAAGATGACCAGCTGAGCGATGAACTGCGAGCGGAA
CTGGCGGCATTGGCGCCGCAGGAAGACTGA