SecReT6
Protein ID: 254785737
SecReT6 ID359
T6SS typei5
Gene symbol-
Locus tagTERTU_1639
StrainTeredinibacter turnerae T7901
Repliconchromosome [GenBank: NC_012997] [Browse all T6SS(s) in this replicon]
Location [Strand]1689583..1690065 [+]
Producttype VI secretion system effector, Hcp1 family
NoteTssD
UniProt IDC5BTY8
KEGG IDttu:TERTU_1639
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.90E-24, Aligned region: 4..135
CD45 [PF12567], Evalue: 0.0097, Aligned region: 42..68
CD45 [PF12567], Evalue: 0.0097, Aligned region: 83..121
Protein Sequence: 160 a.a.     [Download]
>gi|254785737|ref|YP_003073166.1| type VI secretion system effector, Hcp1 family [Teredinibacter turnerae T7901]
MAIYIEWEGIEGNVTADGYAKHMSVDTFSFGVGRSITMEVGNCANREANRPAFSEITLTKLADNSCTSIF
QEATSVSEGKKVVIKFVQTGSDKVTEFMTYTLTECLVSGYSVSANSEGDPLESITVSFCGIEVNYLDFDA
TNKSASPQRVGYDLKAAKPQ
 
Nucleotide Sequence: 483 bp     [Download]
>gi|254784273|ref|NC_012997.1|:1689583-1690065 Teredinibacter turnerae T7901 chromosome, complete genome
ATGGCAATTTACATTGAGTGGGAAGGCATTGAAGGTAATGTAACTGCAGACGGTTACGCAAAGCATATGT
CTGTAGACACATTTAGCTTCGGTGTTGGTCGTTCAATTACCATGGAAGTTGGTAATTGCGCGAACCGTGA
AGCTAACCGACCAGCTTTCAGCGAAATCACTCTAACCAAGCTGGCCGACAACTCATGCACTTCAATTTTC
CAGGAAGCCACAAGTGTTTCTGAAGGCAAAAAAGTCGTAATCAAGTTTGTTCAAACCGGTTCTGACAAGG
TCACTGAGTTTATGACCTACACACTGACTGAGTGTTTGGTTAGCGGTTACAGCGTTTCTGCGAACTCAGA
AGGCGACCCTCTCGAAAGCATCACCGTTAGTTTCTGTGGTATCGAGGTTAACTATCTCGACTTTGACGCA
ACCAATAAGAGCGCAAGCCCACAGCGTGTTGGTTACGATCTTAAGGCTGCCAAGCCCCAGTAA