SecReT6
Protein ID: 254785747
SecReT6 ID359
T6SS typei5
Gene symbolclpV
Locus tagTERTU_1649
StrainTeredinibacter turnerae T7901
Repliconchromosome [GenBank: NC_012997] [Browse all T6SS(s) in this replicon]
Location [Strand]1700803..1703538 [-]
Producttype VI secretion ATPase, ClpV1 family
NoteTssH
UniProt IDC5BTZ8
KEGG IDttu:TERTU_1649
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 4.70E-40, Aligned region: 540..562
AAA_2 [PF07724], Evalue: 4.70E-40, Aligned region: 642..810
AAA [PF00004], Evalue: 2.00E-18, Aligned region: 230..362
AAA [PF00004], Evalue: 2.00E-18, Aligned region: 546..567
AAA [PF00004], Evalue: 2.00E-18, Aligned region: 649..771
ClpB_D2-small [PF10431], Evalue: 6.90E-14, Aligned region: 550..585
ClpB_D2-small [PF10431], Evalue: 6.90E-14, Aligned region: 815..889
AAA_5 [PF07728], Evalue: 1.50E-12, Aligned region: 230..250
AAA_5 [PF07728], Evalue: 1.50E-12, Aligned region: 301..360
AAA_5 [PF07728], Evalue: 1.50E-12, Aligned region: 647..767
AAA_16 [PF13191], Evalue: 4.40E-12, Aligned region: 38..78
AAA_16 [PF13191], Evalue: 4.40E-12, Aligned region: 207..251
AAA_16 [PF13191], Evalue: 4.40E-12, Aligned region: 274..308
AAA_16 [PF13191], Evalue: 4.40E-12, Aligned region: 468..505
AAA_16 [PF13191], Evalue: 4.40E-12, Aligned region: 616..668
AAA_16 [PF13191], Evalue: 4.40E-12, Aligned region: 712..741
AAA_22 [PF13401], Evalue: 8.80E-08, Aligned region: 229..311
AAA_22 [PF13401], Evalue: 8.80E-08, Aligned region: 347..390
AAA_22 [PF13401], Evalue: 8.80E-08, Aligned region: 542..573
AAA_22 [PF13401], Evalue: 8.80E-08, Aligned region: 646..668
AAA_22 [PF13401], Evalue: 8.80E-08, Aligned region: 709..732
Clp_N [PF02861], Evalue: 2.80E-06, Aligned region: 26..75
Clp_N [PF02861], Evalue: 2.80E-06, Aligned region: 105..125
Clp_N [PF02861], Evalue: 2.80E-06, Aligned region: 317..327
Arch_ATPase [PF01637], Evalue: 5.50E-05, Aligned region: 209..382
Arch_ATPase [PF01637], Evalue: 5.50E-05, Aligned region: 646..661
Sigma54_activat [PF00158], Evalue: 8.30E-05, Aligned region: 224..244
Sigma54_activat [PF00158], Evalue: 8.30E-05, Aligned region: 647..771
IstB_IS21 [PF01695], Evalue: 0.00039, Aligned region: 214..249
IstB_IS21 [PF01695], Evalue: 0.00039, Aligned region: 648..666
AAA_19 [PF13245], Evalue: 0.00046, Aligned region: 113..135
AAA_19 [PF13245], Evalue: 0.00046, Aligned region: 228..252
AAA_19 [PF13245], Evalue: 0.00046, Aligned region: 650..669
Zeta_toxin [PF06414], Evalue: 0.00052, Aligned region: 230..250
Zeta_toxin [PF06414], Evalue: 0.00052, Aligned region: 641..687
AAA_25 [PF13481], Evalue: 0.00053, Aligned region: 229..306
AAA_25 [PF13481], Evalue: 0.00053, Aligned region: 645..665
AAA_25 [PF13481], Evalue: 0.00053, Aligned region: 710..731
NACHT [PF05729], Evalue: 0.00054, Aligned region: 230..257
NACHT [PF05729], Evalue: 0.00054, Aligned region: 648..670
AAA_29 [PF13555], Evalue: 0.001, Aligned region: 222..245
AAA_29 [PF13555], Evalue: 0.001, Aligned region: 645..672
AAA_14 [PF13173], Evalue: 0.0015, Aligned region: 230..320
AAA_14 [PF13173], Evalue: 0.0015, Aligned region: 600..614
AAA_14 [PF13173], Evalue: 0.0015, Aligned region: 647..743
AAA_17 [PF13207], Evalue: 0.0025, Aligned region: 58..74
AAA_17 [PF13207], Evalue: 0.0025, Aligned region: 230..248
AAA_17 [PF13207], Evalue: 0.0025, Aligned region: 647..685
AAA_17 [PF13207], Evalue: 0.0025, Aligned region: 834..850
Protein Sequence: 911 a.a.     [Download]
>gi|254785747|ref|YP_003073176.1| type VI secretion ATPase, ClpV1 family [Teredinibacter turnerae T7901]
MISIDLKSLVGKLNDQTRNALEGAAGLCMSRTHYNVEIEHWLLKLLEIPNNDFNLILDKFEISRGKLNQE
LNNELDRIKSGNSRRAALSPAIVDLAKNAWILASVEYNHPIATSAHLIAALLLDENLRRSTNVCSGELSK
ILPESLRDLVRAVVGSTPESENLYAEDSARTMSNASGEIAAPSKSPALDKFTVNLTDAAKAGKLDAVLGR
DDEIRQIIDILIRRRQNNPILTGEAGVGKTAVVEGFALRIASGDVPAPLRGVTIRSLDLGLLQAGASVKG
EFENRLKSVIAEVKASPDPIIMFIDEAHTLIGAGGKEGQGDAANLLKPALARGELRTIAATTWAEYKKYF
ERDPALTRRFQVVKVEEPSEDKAINMMRAISEMLQIHHGVRIMDEAIVDSVKLSSRYITARQLPDKSVSL
LDTACARVALSQSATPAAIEDTRRRITLCETNLLSLQREHATLGNCAEHIADLEKEKLSLTALLEIQENQ
WAAEQEVVTVIHDLQKKIEDDFHAKLQPTGLDSSDEFSSPAPDAAEVETKNTALSIEDAQEIQAQMKEQM
SRLSEIQGETPMIQVNVDSQAIAEVVANWTGIPVGKMVSDEIQSVLKLGEILQKRVIGQDHALSAIAENI
RTSRAGLTDPRKPIGVFFMVGPSGVGKTETALALADILYGGEHNITTINMSEFKEEHKVSILLGSPPGYV
GYGEGGVLTEAVRRKPYSVVLLDEMEKAHPGVQDIFYNLFDKGTIKDGEGRDIDFRNTIIIMTSNAGEEH
IRAMCAACEDKPEPDVLLDNFRPQLLNYFKPAFLGRTNIIPYYPLDDEILVKICAINMNRIEKRLKAQYN
ARFSYDDDLLLHLVARCQDNDTGARNIENIISRSMLPALATQCLARLAESQPIDAVHISVDEDGNFTYQI
D
 
Nucleotide Sequence: 2736 bp     [Download]
>gi|254784273|ref|NC_012997.1|:c1703538-1700803 Teredinibacter turnerae T7901 chromosome, complete genome
ATGATATCAATCGACTTAAAATCGTTAGTTGGAAAATTAAATGATCAAACTCGGAACGCCTTGGAGGGAG
CGGCAGGCCTTTGCATGTCACGCACCCATTACAATGTGGAGATAGAGCATTGGTTGCTGAAACTACTTGA
GATACCCAATAACGATTTTAATCTTATACTCGACAAGTTCGAAATTAGCCGTGGTAAGCTTAATCAGGAG
CTCAATAACGAACTCGATCGGATAAAATCAGGCAACTCGCGACGCGCAGCCCTATCACCTGCAATTGTAG
ACTTGGCTAAAAACGCATGGATACTTGCCTCAGTCGAATACAACCACCCAATCGCTACATCAGCACATCT
AATAGCAGCATTGCTTCTAGACGAGAATCTTCGCAGATCAACTAATGTCTGCTCTGGCGAACTAAGTAAA
ATCCTACCCGAGTCGCTTCGTGATCTGGTGCGTGCGGTAGTTGGCAGTACTCCCGAGTCAGAAAATCTCT
ACGCGGAAGATTCCGCGCGAACAATGTCAAACGCGAGCGGAGAAATCGCCGCACCGAGTAAATCGCCCGC
GTTAGACAAGTTCACCGTTAACCTCACTGATGCAGCGAAAGCGGGTAAGCTCGATGCAGTACTGGGTCGA
GATGACGAAATTCGTCAGATTATAGATATTTTGATCCGCCGCCGCCAAAACAATCCCATCCTCACCGGCG
AAGCGGGTGTGGGCAAAACGGCAGTTGTAGAGGGATTCGCCCTCCGAATCGCGTCCGGAGACGTACCCGC
GCCACTACGAGGTGTCACCATTCGAAGCTTGGACTTGGGGCTGCTGCAAGCTGGCGCAAGTGTCAAAGGC
GAATTCGAAAATCGTCTCAAGTCTGTGATCGCTGAAGTTAAAGCTTCACCAGACCCGATTATTATGTTTA
TCGATGAGGCTCACACGCTCATAGGCGCGGGCGGCAAAGAGGGGCAAGGGGATGCAGCGAACTTGTTAAA
ACCCGCGCTAGCGCGCGGCGAACTGCGCACCATCGCAGCTACAACCTGGGCGGAGTATAAAAAATATTTT
GAGAGAGACCCGGCTTTAACACGGCGCTTTCAGGTGGTAAAAGTGGAGGAGCCGAGTGAAGACAAAGCCA
TAAACATGATGCGTGCTATATCCGAAATGCTCCAGATACACCACGGAGTACGTATTATGGACGAAGCCAT
CGTCGACTCGGTTAAACTTTCAAGCCGCTATATTACTGCGAGACAGCTGCCGGACAAATCCGTCAGCCTC
CTCGATACAGCCTGCGCGCGCGTGGCACTTAGTCAAAGCGCAACTCCCGCAGCAATAGAAGACACCCGTA
GACGCATAACTTTATGCGAAACTAATCTGCTCTCACTGCAGCGTGAACACGCTACGCTAGGGAACTGTGC
AGAACATATTGCAGACTTGGAAAAAGAAAAATTGTCCCTCACCGCCCTACTGGAAATTCAGGAAAATCAG
TGGGCCGCTGAGCAAGAAGTCGTAACGGTTATTCACGATCTACAGAAAAAAATAGAAGACGACTTTCACG
CAAAACTACAGCCCACAGGTCTTGATTCGTCCGATGAATTTTCATCACCTGCGCCAGACGCGGCAGAAGT
AGAGACCAAAAATACGGCATTATCCATTGAGGATGCGCAGGAAATCCAAGCGCAAATGAAAGAGCAGATG
AGCAGACTTTCAGAAATTCAAGGCGAAACGCCAATGATACAGGTCAACGTGGATAGTCAGGCGATAGCGG
AGGTTGTCGCAAACTGGACCGGAATACCCGTTGGTAAAATGGTATCAGACGAAATTCAATCCGTGCTCAA
ACTGGGTGAAATACTGCAGAAGCGGGTGATTGGTCAGGATCACGCCCTGTCCGCAATCGCCGAAAATATT
CGGACCTCACGCGCAGGACTAACAGACCCTCGCAAGCCCATCGGTGTGTTTTTTATGGTGGGACCAAGTG
GTGTTGGTAAAACTGAAACAGCTCTCGCACTTGCAGATATTCTCTATGGCGGAGAACATAATATTACAAC
AATTAACATGTCCGAATTTAAAGAGGAGCATAAAGTTTCCATACTGCTCGGGTCGCCTCCCGGCTACGTC
GGCTACGGTGAGGGAGGCGTACTCACCGAAGCCGTTCGCCGCAAGCCTTATAGCGTGGTCTTGCTGGACG
AAATGGAAAAGGCGCATCCTGGCGTGCAGGACATATTCTACAATCTATTCGATAAAGGCACGATAAAAGA
CGGAGAAGGCCGTGATATCGATTTTAGAAATACCATCATTATTATGACCTCCAATGCAGGAGAAGAACAC
ATCAGGGCGATGTGTGCGGCATGTGAGGATAAGCCGGAACCGGACGTTCTGCTCGATAATTTTAGGCCAC
AGCTGCTAAATTACTTCAAGCCCGCTTTTTTGGGGCGGACAAATATCATCCCCTATTACCCGCTTGACGA
TGAGATACTTGTAAAAATATGCGCAATCAATATGAATCGCATTGAAAAGCGTTTAAAAGCCCAGTACAAC
GCACGCTTTTCCTACGATGACGATCTACTGCTTCATCTTGTAGCGCGTTGCCAGGACAACGACACAGGGG
CAAGAAATATTGAAAACATCATCTCGAGATCGATGCTACCCGCATTAGCAACGCAGTGCCTTGCACGGTT
AGCTGAGAGTCAGCCAATTGATGCCGTACATATATCTGTCGACGAAGATGGAAATTTCACGTACCAAATC
GACTGA