SecReT6
Protein ID: 254785748
SecReT6 ID359
T6SS typei5
Gene symbol-
Locus tagTERTU_1650
StrainTeredinibacter turnerae T7901
Repliconchromosome [GenBank: NC_012997] [Browse all T6SS(s) in this replicon]
Location [Strand]1703569..1704684 [-]
Producttype VI secretion protein
NoteTssG
UniProt IDC5BTZ9
KEGG IDttu:TERTU_1650
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.50E-89, Aligned region: 19..350
Protein Sequence: 371 a.a.     [Download]
>gi|254785748|ref|YP_003073177.1| type VI secretion protein [Teredinibacter turnerae T7901]
MPTKSRSKSLSVIRRLLTNTGEFAFAQAVRLLERSAAYRKPDQKVNTQQAGKYSPAYQEVVRFKGNPSLG
FPESEIESIEQLSNEQQSHYFKVTTNFLGLTGSMGVLPYHYSELAIQRSKKRDKHLQNFLDLFNHRILSI
FYQASIKYRLPLNYELSQLSRTQQKTLEKHDDRITQSVLALIGLGGKHLTDRHSIHDETLIFYAGLLAQQ
VKTASGLQQILSHYFSIPVSIKEFVGQWQPLIDDVRTRLPSPGMPEGQNACLGKSCMLGNQGWFAQGKIQ
IHLGPLTSEQHRSFAPGSRTFTALNELCRFYLGMERDFEFVLKVKRSHIRDKIQLGNQNAPIMGWSTWLA
STEQGTDQQTSIMDIRISSSC
 
Nucleotide Sequence: 1116 bp     [Download]
>gi|254784273|ref|NC_012997.1|:c1704684-1703569 Teredinibacter turnerae T7901 chromosome, complete genome
ATGCCCACCAAGAGCAGGTCAAAAAGTCTTTCTGTAATTCGTCGCCTACTGACGAATACCGGAGAGTTTG
CATTCGCACAGGCAGTTCGTTTGCTTGAAAGGTCGGCCGCCTACAGAAAACCAGACCAAAAAGTGAACAC
TCAGCAAGCGGGTAAGTATTCGCCTGCCTATCAGGAAGTGGTTAGGTTTAAGGGCAATCCCTCGCTCGGA
TTTCCTGAGTCAGAAATCGAATCCATCGAACAGCTAAGCAATGAGCAGCAGTCACACTATTTCAAAGTAA
CAACAAATTTTTTGGGCTTAACAGGAAGCATGGGGGTTCTGCCCTATCACTATAGCGAACTGGCAATCCA
GCGAAGTAAAAAACGGGACAAACACTTACAAAATTTTCTGGACCTTTTTAACCACCGGATCTTGTCCATT
TTTTATCAGGCTTCAATCAAATATAGATTGCCCCTCAACTACGAGCTAAGCCAGCTAAGTCGGACCCAAC
AAAAAACGCTGGAGAAGCATGACGATAGGATAACCCAATCGGTTCTCGCTTTAATTGGATTGGGCGGAAA
ACATCTTACTGACCGACACTCGATCCACGACGAAACACTGATCTTTTACGCCGGGCTTTTGGCACAGCAG
GTTAAAACTGCCAGTGGGCTACAACAAATACTCTCCCATTATTTTTCCATACCCGTGTCAATCAAAGAGT
TTGTCGGTCAATGGCAACCACTAATTGACGATGTACGAACAAGACTGCCATCTCCCGGGATGCCAGAGGG
ACAAAATGCCTGCCTCGGTAAAAGTTGCATGCTGGGGAACCAAGGTTGGTTCGCACAGGGCAAAATACAG
ATTCACTTGGGCCCCCTAACCAGTGAACAGCACCGTAGCTTCGCACCCGGCAGCCGAACATTTACAGCAC
TAAACGAGCTTTGCCGATTTTATCTAGGAATGGAGCGGGATTTCGAATTTGTACTTAAAGTAAAGCGTTC
CCACATTAGAGACAAAATCCAGTTAGGAAACCAAAACGCACCGATAATGGGTTGGAGCACTTGGCTCGCC
TCCACGGAGCAAGGCACAGATCAACAAACCTCTATCATGGACATCAGAATATCGTCTAGCTGTTAA