SecReT6
Protein ID: 254785749
SecReT6 ID359
T6SS typei5
Gene symbolvasA
Locus tagTERTU_1651
StrainTeredinibacter turnerae T7901
Repliconchromosome [GenBank: NC_012997] [Browse all T6SS(s) in this replicon]
Location [Strand]1704648..1706483 [-]
Producttype VI secretion protein
NoteTssF
UniProt IDC5BU00
KEGG IDttu:TERTU_1651
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 2.40E-207, Aligned region: 5..609
Protein Sequence: 611 a.a.     [Download]
>gi|254785749|ref|YP_003073178.1| type VI secretion protein [Teredinibacter turnerae T7901]
MSDELLPYYEKELAFIRQMGAEFSRENPKIAGRLGINADTIEDPHVSRLIEAFAYLNARTQHKLDDDFPE
LTDALLNVMFPHYLRPIPSMSIVTFEPDEDQLDSKYTVDRNTELETEYFQGENCRFTTAYPVDMYPLKIT
SANLIGRPFLTPGAEKMASCAGVLKISLETFNNDINIQEIGLDKLRLYLRGQPQHVHPLYRMLLKECQKI
ALGGCTDELHPTFMESSHIQAVGFGEDEGLLPYPPNSFLGYRLLTEYFAFAEKFMFIDICNLGEHLPASA
QNQLDIYLYLTNSEVELEHNINIDTFVLGATPIINTFKHKCDPIKLNHNHAEYLLLADSRRPKGYEIQAV
DEVIASTSSGEKAPFLPFYGIKHEHKDPTEHAYWYATRRPARSGFAERDDGTDVYISLVDLEFNPNIPDD
RTLTISAICSNRDLPRKLPFGVDQPRLQCAHSSPPTKAIRCLLRPTATIRPPLRDGARWRLLSHLNLNHL
SLIGGSKATEALKEILRLYDFTETSVSRALVDSIMQVNAHAISAPLPINGHTTMCRGVEIEITLDNALLT
GSSSYLYASVLEHFFAAYCSVNSFTRVLVKLKNREDYLKKCPPRAGQKVFL
 
Nucleotide Sequence: 1836 bp     [Download]
>gi|254784273|ref|NC_012997.1|:c1706483-1704648 Teredinibacter turnerae T7901 chromosome, complete genome
ATGTCTGATGAATTGTTGCCCTACTATGAAAAAGAACTCGCTTTCATTCGCCAAATGGGGGCCGAGTTTT
CACGTGAAAACCCAAAAATTGCGGGGCGCTTGGGCATTAATGCGGATACCATTGAAGACCCACATGTATC
ACGATTAATCGAAGCATTTGCCTACCTTAATGCGCGCACCCAACACAAGCTTGACGACGACTTTCCTGAA
CTAACTGACGCTCTTCTCAATGTGATGTTTCCTCACTACCTGCGTCCGATTCCTTCCATGTCGATTGTCA
CCTTCGAGCCGGACGAAGATCAGTTAGATAGCAAATATACGGTAGATCGAAACACCGAGTTAGAGACAGA
ATATTTTCAGGGCGAAAACTGTCGGTTCACCACTGCATATCCGGTGGATATGTACCCCCTTAAAATTACC
TCAGCAAATCTTATTGGCAGACCATTTTTGACTCCCGGCGCTGAAAAAATGGCAAGCTGTGCAGGCGTAC
TAAAAATCAGCCTGGAAACGTTTAATAATGACATTAATATCCAAGAGATTGGGCTCGACAAATTGCGTCT
CTATCTGCGAGGCCAGCCGCAGCATGTTCATCCGCTCTACCGAATGCTGCTAAAAGAATGTCAGAAAATC
GCACTGGGGGGTTGCACTGATGAGCTTCACCCGACGTTTATGGAAAGCAGCCACATCCAAGCCGTAGGAT
TTGGGGAAGATGAAGGACTATTGCCATACCCACCTAATTCTTTCCTGGGCTACCGGCTATTGACGGAATA
TTTTGCATTTGCCGAAAAATTTATGTTCATCGATATATGTAATCTTGGTGAACACCTGCCGGCTTCTGCC
CAGAATCAGCTGGATATTTATTTGTACCTCACCAATAGCGAAGTCGAGCTTGAACACAATATTAACATCG
ACACTTTCGTACTTGGTGCGACGCCGATCATAAACACGTTTAAGCACAAATGCGATCCAATAAAGCTCAA
CCACAACCATGCGGAATACCTATTACTGGCGGATTCACGGCGCCCGAAAGGCTATGAAATACAAGCGGTG
GACGAAGTAATCGCCTCCACTTCGAGCGGCGAAAAGGCTCCATTTCTGCCTTTTTACGGAATCAAGCATG
AACATAAAGACCCGACGGAACATGCCTATTGGTATGCCACACGCCGACCCGCGAGATCAGGTTTTGCCGA
AAGAGATGACGGTACAGATGTTTACATAAGCCTGGTGGATCTGGAATTTAACCCCAACATCCCGGACGAC
AGAACACTTACGATAAGTGCGATCTGTAGCAACCGGGACCTACCGCGAAAATTGCCGTTCGGCGTAGACC
AACCTCGTCTGCAATGCGCACATAGCTCACCACCCACTAAGGCCATACGCTGCTTGTTACGCCCAACGGC
AACTATCCGACCACCACTTCGAGATGGTGCCCGTTGGCGATTACTATCACATTTAAATTTAAATCACTTA
TCGTTAATTGGCGGATCAAAAGCGACAGAGGCTTTAAAAGAGATTTTAAGACTATACGACTTCACAGAAA
CGTCAGTGTCACGCGCGTTGGTTGATTCAATCATGCAAGTCAATGCTCATGCGATCAGCGCGCCACTGCC
TATCAACGGACATACCACTATGTGCCGAGGCGTTGAAATTGAAATTACCTTGGACAACGCGCTACTTACG
GGCAGCAGCTCCTACCTCTACGCAAGTGTGCTGGAGCACTTTTTCGCCGCGTACTGCTCAGTTAACTCGT
TTACGCGCGTGCTAGTTAAATTGAAAAACCGAGAAGATTACCTAAAAAAATGCCCACCAAGAGCAGGTCA
AAAAGTCTTTCTGTAA