SecReT6
Protein ID: 254785750
SecReT6 ID359
T6SS typei5
Gene symbol-
Locus tagTERTU_1652
StrainTeredinibacter turnerae T7901
Repliconchromosome [GenBank: NC_012997] [Browse all T6SS(s) in this replicon]
Location [Strand]1706476..1706973 [-]
Producttype VI secretion system lysozyme-related protein
NoteTssE
UniProt IDC5BU01
KEGG IDttu:TERTU_1652
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 2.70E-22, Aligned region: 37..142
Protein Sequence: 165 a.a.     [Download]
>gi|254785750|ref|YP_003073179.1| type VI secretion system lysozyme-related protein [Teredinibacter turnerae T7901]
MARVEKTKNLRPSILDRLLDDDPRSPREPEVTKHQQLRNLRASVKRDLENLLNTRYRIVSPPENLKQLEN
SILNYGMPDLATVNVSDIEKRRAFTRELEQLLKTYEPRFKTVHVSYQDNSDTTDRTLRFRIDATLYADPS
PEVIVFDSVLEPVSRAVNVEESPHV
 
Nucleotide Sequence: 498 bp     [Download]
>gi|254784273|ref|NC_012997.1|:c1706973-1706476 Teredinibacter turnerae T7901 chromosome, complete genome
ATGGCCCGTGTAGAAAAAACAAAAAACCTGCGCCCCTCTATCCTGGATCGACTATTGGATGACGACCCGC
GCTCGCCCCGGGAACCAGAAGTAACAAAACACCAGCAATTACGTAACCTGCGAGCAAGCGTGAAACGTGA
CCTTGAAAACCTATTGAACACTCGTTATCGCATTGTGTCGCCACCCGAGAATCTGAAACAATTGGAAAAC
TCCATTCTCAACTACGGCATGCCCGATCTTGCAACAGTCAATGTGTCAGATATTGAAAAACGGCGCGCTT
TTACGCGAGAACTGGAGCAGTTACTTAAAACGTACGAACCGCGTTTTAAGACAGTACACGTTAGCTATCA
GGACAATTCAGACACCACGGATCGCACCCTGCGATTTCGCATAGACGCAACTTTGTACGCAGATCCATCC
CCGGAAGTCATTGTATTCGATTCAGTTCTTGAACCCGTTTCACGCGCAGTCAACGTAGAAGAATCCCCCC
ATGTCTGA