SecReT6
Protein ID: 254785751
SecReT6 ID359
T6SS typei5
Gene symbol-
Locus tagTERTU_1653
StrainTeredinibacter turnerae T7901
Repliconchromosome [GenBank: NC_012997] [Browse all T6SS(s) in this replicon]
Location [Strand]1706985..1708421 [-]
Producttype VI secretion protein, EvpB/family
NoteTssC
UniProt IDC5BU02
KEGG IDttu:TERTU_1653
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 9.50E-161, Aligned region: 43..474
Protein Sequence: 478 a.a.     [Download]
>gi|254785751|ref|YP_003073180.1| type VI secretion protein, EvpB/family [Teredinibacter turnerae T7901]
MVGTLTTLDKFLASPASFDSLVSFVNTYFIEPPATAEELYCEIDQIIASIDELVISQLNAILHHPNFQKI
EASWRGLWYLVVQAEGVRNLKIKLLNANWLEVTKDIERALDFDQSQLYQKIYSEEYGTPGGEPYGVIIGD
YDIHHKPNAQHPDDISTLDGLADIGSAAFTPFILGASPQLLGSNNFTELGQGSRLGDVFSQSEYIRWRSL
REKPEARFVGLTLPRILMRTPYRKTTGSYKGLRFRELPGNANQEAYLWGNAAYAFGGILIREFAAVGWFG
HIRGVPRDLLGGGLVTNLPMDSFDTDKTGVAFKPATDILITDALEREISELGMVPLCHCYNTPFAAFYSN
QSVQSVNRASNSTTAINYKLSTMLQHVLCASRVAHYIKVMIRDKVGSFLSAEECQVYLGTWLRRYTTGRH
DLEWEQQARYPLREANVTVREHPEKPGQYLCVIHLVPHYQIDQMVSELELVTELVQSN
 
Nucleotide Sequence: 1437 bp     [Download]
>gi|254784273|ref|NC_012997.1|:c1708421-1706985 Teredinibacter turnerae T7901 chromosome, complete genome
GTGGTAGGCACGTTAACCACCCTCGATAAATTTTTGGCCTCACCAGCTTCGTTCGACTCCCTCGTCTCTT
TTGTAAATACCTATTTCATTGAGCCGCCCGCAACCGCAGAAGAGTTGTACTGCGAAATTGATCAAATTAT
TGCGTCTATTGATGAACTGGTGATATCACAGCTCAACGCGATCTTGCATCACCCAAACTTTCAGAAAATC
GAAGCGTCCTGGCGTGGGTTATGGTATCTCGTGGTACAGGCCGAAGGTGTACGAAATCTAAAAATCAAAC
TGCTAAATGCGAATTGGCTAGAGGTCACGAAGGATATTGAACGCGCACTGGATTTCGACCAAAGCCAGCT
CTATCAAAAAATCTACAGTGAAGAATATGGCACACCCGGCGGTGAACCTTACGGCGTGATTATTGGTGAT
TATGATATTCACCATAAACCGAATGCACAGCACCCCGATGATATATCCACTCTAGACGGCCTTGCCGACA
TTGGCTCCGCGGCCTTCACGCCATTTATCCTAGGTGCCTCGCCTCAGCTCCTCGGCAGCAATAATTTTAC
AGAGCTGGGTCAGGGGAGCCGACTTGGCGATGTATTCTCGCAGTCTGAATATATCCGCTGGCGTAGCCTC
AGAGAAAAGCCTGAAGCCAGATTCGTTGGCTTGACTTTGCCGCGTATTCTTATGCGGACACCCTATCGCA
AAACAACGGGCAGCTACAAAGGCCTGAGATTTCGCGAACTACCGGGCAACGCCAATCAGGAAGCCTACCT
ATGGGGAAATGCCGCCTACGCCTTCGGCGGCATACTGATTCGGGAATTTGCGGCCGTGGGCTGGTTTGGT
CACATCCGAGGCGTACCTCGCGATTTGCTGGGTGGTGGACTTGTTACCAATTTGCCGATGGACTCTTTCG
ACACGGACAAAACCGGTGTCGCATTCAAACCCGCAACCGACATTCTTATTACAGATGCGCTGGAGCGAGA
AATTAGTGAGTTGGGAATGGTCCCTCTCTGTCATTGTTACAACACACCTTTTGCGGCGTTTTACAGTAAC
CAGTCAGTGCAATCTGTTAATCGCGCGTCTAACTCTACGACGGCAATTAACTACAAGCTTTCTACTATGC
TGCAACACGTGCTATGCGCCTCTCGCGTAGCACACTACATCAAGGTGATGATACGCGATAAAGTCGGGTC
GTTTTTGTCCGCTGAGGAATGCCAGGTTTACCTCGGCACTTGGCTCCGCCGTTACACCACCGGGCGTCAC
GACCTGGAGTGGGAACAACAGGCTCGCTACCCGCTGCGTGAAGCTAATGTAACGGTGCGAGAGCATCCGG
AAAAACCGGGCCAATACCTCTGTGTGATTCACCTTGTACCTCACTACCAGATCGATCAGATGGTGTCTGA
ACTCGAATTGGTTACAGAATTGGTTCAATCCAACTAG