SecReT6
Protein ID: 254785753
SecReT6 ID359
T6SS typei5
Gene symbol-
Locus tagTERTU_1656
StrainTeredinibacter turnerae T7901
Repliconchromosome [GenBank: NC_012997] [Browse all T6SS(s) in this replicon]
Location [Strand]1708917..1710413 [-]
Producttype VI secretion protein, EvpB/family
NoteTssC
UniProt IDC5BU04
KEGG IDttu:TERTU_1656
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.60E-191, Aligned region: 65..495
Protein Sequence: 498 a.a.     [Download]
>gi|254785753|ref|YP_003073182.1| type VI secretion protein, EvpB/family [Teredinibacter turnerae T7901]
MANNEELMEGQASATEVATDLSFLEQAIDATKQTPRDETEELLKTLTREATKGTVKWDKNLSVTINAAIN
AIDEAMSNQLRAIMHHEKFQTLEGSWRGLQYLVMNSETSSHLKLRVMNISKKELKRDLEKAVEFDQSQIF
KKVYESEFGTAGGEPYAALVGDYDFSSHPDDISLLTKMSNIAASGFCPFVSSAAPQMFGFESFTELSKPR
DLEKIFESAEYIQWRSFRESEDSRFVTLTMPRTLARLPYGAATKPVEEFNFEEGNVTADGKHLENEHDSY
CWMNAAYTLGATLSKAFASYGWCTSIRGAEGGGKVEGLPSHVFVSDDGDTDQKCPTEIGITDRREAELSK
LGFLPLCHYKNTDFAVFFGAQTTQKPKKFDDPDASANSAISARLPYIMATSRIAHFLKVMARDKIGSFME
ADEAERWLNKWLSQYVNGTPGASAEMKAKYPLAEARVEVKEVPGQPGVFNAVAYLRPWLQVEELTASLRL
VANIPKAG
 
Nucleotide Sequence: 1497 bp     [Download]
>gi|254784273|ref|NC_012997.1|:c1710413-1708917 Teredinibacter turnerae T7901 chromosome, complete genome
ATGGCGAATAATGAAGAATTAATGGAAGGCCAGGCGAGTGCAACAGAAGTTGCCACGGACCTGAGCTTCC
TCGAACAAGCGATTGACGCAACCAAACAAACGCCACGCGATGAAACCGAAGAGCTGTTGAAGACACTCAC
TCGTGAAGCAACGAAAGGCACTGTAAAGTGGGACAAAAACCTCAGCGTAACAATCAACGCTGCGATTAAC
GCGATCGACGAGGCAATGTCTAATCAGTTGCGGGCCATCATGCACCATGAAAAGTTTCAAACGCTGGAAG
GTTCATGGCGTGGCTTGCAGTACCTGGTGATGAATTCTGAAACAAGCTCGCACCTTAAACTGCGAGTGAT
GAATATCAGCAAAAAAGAGCTCAAGCGCGACTTGGAAAAGGCGGTCGAATTCGACCAAAGCCAGATATTC
AAGAAAGTGTACGAAAGCGAATTCGGCACTGCGGGTGGAGAACCCTACGCCGCTCTCGTCGGCGACTACG
ACTTTTCATCTCACCCCGATGATATTTCTCTGCTCACCAAAATGTCGAATATCGCCGCATCTGGTTTCTG
CCCATTTGTTTCATCAGCAGCACCACAAATGTTTGGTTTCGAATCATTTACAGAGCTCTCTAAACCTCGC
GACCTGGAAAAAATATTCGAATCTGCGGAGTACATTCAATGGCGGAGTTTCCGCGAAAGTGAAGACTCCC
GCTTTGTAACCCTGACCATGCCCCGCACGCTCGCACGCCTGCCGTATGGCGCAGCCACAAAACCGGTAGA
AGAGTTCAATTTCGAAGAAGGTAACGTTACCGCCGACGGTAAGCATCTCGAGAATGAGCACGATTCCTAT
TGCTGGATGAACGCGGCTTATACGTTAGGTGCAACACTGAGCAAAGCTTTCGCCAGTTATGGTTGGTGCA
CCAGTATTCGAGGTGCTGAGGGTGGCGGTAAGGTAGAAGGTCTACCCAGTCACGTTTTCGTAAGTGATGA
TGGCGATACCGATCAGAAATGCCCAACCGAAATAGGCATCACAGATCGCCGTGAAGCAGAACTGAGTAAA
CTTGGTTTTCTGCCGCTGTGTCATTACAAGAACACAGATTTTGCGGTATTTTTCGGCGCGCAAACTACGC
AAAAGCCGAAGAAATTCGACGACCCTGATGCCTCTGCCAATTCTGCCATATCTGCGCGCCTGCCCTACAT
CATGGCCACTTCCCGTATCGCCCACTTTCTCAAAGTTATGGCACGGGACAAAATTGGCTCCTTTATGGAA
GCCGATGAAGCCGAGCGCTGGCTAAACAAATGGCTGAGTCAATATGTGAATGGAACACCGGGCGCTAGCG
CAGAAATGAAAGCGAAGTATCCTTTAGCAGAAGCCCGCGTGGAAGTGAAAGAAGTCCCAGGTCAGCCAGG
AGTATTTAACGCAGTAGCCTATTTGCGACCCTGGCTCCAAGTGGAGGAACTGACCGCGTCGCTGAGGCTC
GTCGCCAATATTCCTAAAGCGGGTTAA