SecReT6
Protein ID: 254785754
SecReT6 ID359
T6SS typei5
Gene symbol-
Locus tagTERTU_1657
StrainTeredinibacter turnerae T7901
Repliconchromosome [GenBank: NC_012997] [Browse all T6SS(s) in this replicon]
Location [Strand]1710403..1710924 [-]
Producttype VI secretion protein
NoteTssB
UniProt IDC5BU05
KEGG IDttu:TERTU_1657
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 5.90E-59, Aligned region: 9..163
Protein Sequence: 173 a.a.     [Download]
>gi|254785754|ref|YP_003073183.1| type VI secretion protein [Teredinibacter turnerae T7901]
MSESMQDKLGRVRKPRVHITYDLETNGQVMEKEIPFVMGVMGDYSGDNADEKKPLKDRKFAQVDRDNFNE
LMAKINPQLNMKVENTVDNDGSEMAVNLSFNSMEDFEPQKLVDQVEPLRKLMETRNKLRDLLTKADRSEQ
LENVLEEVLSNTEALANLSGELGVENEGEKDGE
 
Nucleotide Sequence: 522 bp     [Download]
>gi|254784273|ref|NC_012997.1|:c1710924-1710403 Teredinibacter turnerae T7901 chromosome, complete genome
ATGTCAGAAAGTATGCAAGATAAACTCGGAAGAGTCCGCAAACCCCGCGTACACATTACCTACGACCTCG
AAACCAATGGCCAGGTAATGGAAAAAGAAATTCCCTTTGTAATGGGCGTAATGGGAGATTATTCGGGTGA
CAACGCCGATGAGAAAAAACCATTAAAAGACCGCAAGTTCGCACAGGTCGACCGCGATAACTTCAACGAG
CTGATGGCGAAAATCAATCCGCAGCTAAACATGAAGGTAGAAAACACCGTAGACAATGACGGCTCTGAGA
TGGCTGTAAATCTGAGCTTTAACAGCATGGAAGATTTTGAGCCACAAAAGCTCGTCGACCAGGTGGAACC
GCTGCGGAAGCTGATGGAAACCAGAAACAAGCTGCGTGATCTGCTCACCAAAGCGGACCGCTCCGAACAA
CTGGAAAACGTGCTGGAAGAAGTTCTGAGCAATACCGAAGCCCTGGCAAATCTCTCCGGTGAGTTGGGTG
TAGAAAACGAAGGTGAAAAAGATGGCGAATAA