SecReT6
Protein ID: 254785755
SecReT6 ID359
T6SS typei5
Gene symbol-
Locus tagTERTU_1658
StrainTeredinibacter turnerae T7901
Repliconchromosome [GenBank: NC_012997] [Browse all T6SS(s) in this replicon]
Location [Strand]1710954..1712075 [-]
Producttype VI secretion-associated protein, ImpA family
NoteTssA
UniProt IDC5BU06
KEGG IDttu:TERTU_1658
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 6.00E-23, Aligned region: 65..126
Protein Sequence: 373 a.a.     [Download]
>gi|254785755|ref|YP_003073184.1| type VI secretion-associated protein, ImpA family [Teredinibacter turnerae T7901]
MSSASLFDIEQILSPIPGEVDTGVDVRTDPSPTSTYQTIKAARSAARAAERNSIHDGHSNEADDHWRVIK
NLAPELIAAQAKDLEVACWYTEALLRSNGFQGLRDGFRLMLGLIENFWPNLYPMPDEDGIETRVACLAGL
NGEGAEGVLIAPIRRTEITEGSTIGPFTYWEYQQALDCQKVADEKSKQAKIAKLGFSLDNIETAIRETDN
LFFENIRDDLTDAITNYRKVSQLLDEHCGTYDAPPTRTIIEVLEECLGAINHLAKDKLPLPETPQETPVE
EPHQAEEQAANVPQQVQISAPTHLENREAAFRQLVDIAEFFRKNEPHSPVSYMLQKAVKWGRMPLNELMQ
ELIPDTSSRSHFSEITGVLAEDE
 
Nucleotide Sequence: 1122 bp     [Download]
>gi|254784273|ref|NC_012997.1|:c1712075-1710954 Teredinibacter turnerae T7901 chromosome, complete genome
ATGAGCTCAGCTAGTCTTTTCGATATAGAGCAAATATTGTCGCCTATTCCAGGCGAAGTCGACACGGGTG
TCGATGTGCGCACGGACCCCTCGCCAACATCCACGTATCAGACCATTAAAGCGGCGCGCAGCGCAGCGCG
TGCTGCCGAACGCAATAGTATTCATGATGGCCACAGTAACGAAGCGGACGATCACTGGCGAGTTATCAAA
AATCTAGCGCCTGAGCTTATCGCGGCGCAGGCAAAAGATCTGGAAGTCGCCTGTTGGTATACAGAGGCAC
TGCTCCGCTCAAACGGATTTCAAGGCCTGAGAGATGGGTTTCGGCTCATGCTGGGGCTGATAGAAAATTT
TTGGCCAAATTTATACCCAATGCCCGATGAAGATGGCATTGAGACGCGCGTGGCCTGCCTGGCCGGTCTT
AACGGCGAGGGTGCTGAAGGTGTGTTGATCGCCCCGATTCGACGTACAGAAATTACAGAAGGCTCGACAA
TTGGCCCTTTCACCTACTGGGAGTACCAACAGGCACTGGATTGCCAAAAAGTTGCTGATGAAAAGTCCAA
GCAGGCAAAAATTGCCAAGCTCGGTTTCAGCCTAGACAATATAGAAACTGCAATACGAGAAACGGACAAC
CTCTTTTTTGAAAACATTCGGGATGATTTGACGGACGCGATCACAAACTACCGAAAGGTTAGTCAACTTC
TGGATGAACACTGCGGGACCTACGACGCGCCGCCCACACGAACCATAATCGAGGTTCTGGAAGAATGTCT
TGGCGCAATCAATCACCTTGCTAAGGACAAGCTTCCACTTCCGGAAACCCCTCAGGAAACACCCGTCGAG
GAACCGCATCAGGCGGAGGAGCAAGCGGCCAATGTACCGCAACAAGTACAGATTTCCGCTCCAACCCATT
TAGAAAATCGAGAAGCCGCATTTCGACAATTGGTTGATATCGCTGAGTTTTTCCGCAAAAACGAACCCCA
CTCCCCCGTATCCTACATGCTCCAAAAGGCAGTAAAGTGGGGTCGTATGCCGCTAAATGAATTGATGCAG
GAATTGATACCCGACACATCTTCGAGAAGTCACTTTAGTGAGATAACCGGCGTGCTAGCCGAAGATGAAT
AA