SecReT6
Protein ID: 254785756
SecReT6 ID359
T6SS typei5
Gene symbol-
Locus tagTERTU_1660
StrainTeredinibacter turnerae T7901
Repliconchromosome [GenBank: NC_012997] [Browse all T6SS(s) in this replicon]
Location [Strand]1712682..1714319 [+]
Producttype VI secretion system FHA domain-containing protein
NoteFha
UniProt IDC5BU07
KEGG IDttu:TERTU_1660
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 1.20E-14, Aligned region: 29..97
Protein Sequence: 545 a.a.     [Download]
>gi|254785756|ref|YP_003073185.1| type VI secretion system FHA domain-containing protein [Teredinibacter turnerae T7901]
MVLKVEVLQSPQGVAMAEASKSISEQGGSLGRGENNTWVLDDPERFLSSRHCEFDCDGSTYYLTDVSTNG
TFVNGSPDPLGRGVRVALSGGDTIEIGEYQFRVAIEGDTAHSMPLEPVAGSPVLDPFASPSSPFDQPVSS
IPADLDDPLAEFGSGLSSGGGLLPDSDLALNETDPLAALDKAAADPFTASSDPFGISETNDFGTESFPYG
QNTYSDNSDPLSGSFDAPKSSGAGLIPEDWEDDLLGAEPLPTFDEPPKPAAPPLVTAADELVAKRPNPRP
TPRSRPAENNARRDLSQPNRVIRKASRPATTEKRTPLDRSSANDTVEQAAVPKSKPSPRHASTSEVAINS
ALFESMGLDVSQLSQEEQQEVACAVGELMPVVVEGMMRVLRSRASIKNEFRMSVTTMQPIENNPLKFSAD
KGEALDIMFVRKSKAYKAPVAAFSEGFDAIAEHQVAIIAGIRAAFTKMVEHFDPAALEQQFDKQNKGVNI
PGMQKSRYWNSYTAYFQGFMDNMEQSFQNLFGDEFVRAYEDQLFKLMTARNISEK
 
Nucleotide Sequence: 1638 bp     [Download]
>gi|254784273|ref|NC_012997.1|:1712682-1714319 Teredinibacter turnerae T7901 chromosome, complete genome
ATGGTATTAAAAGTGGAAGTGTTGCAGTCGCCGCAGGGAGTTGCCATGGCTGAGGCGAGCAAGTCCATTT
CTGAGCAGGGTGGCTCATTAGGGAGAGGCGAAAATAATACCTGGGTATTAGATGACCCAGAGCGTTTTCT
TTCGAGCCGACATTGCGAATTCGACTGTGACGGCAGCACGTACTATCTTACCGACGTTAGCACTAACGGT
ACTTTTGTGAATGGCTCTCCAGATCCACTCGGCCGAGGTGTCCGCGTCGCTTTGTCTGGCGGAGATACCA
TCGAGATAGGCGAGTACCAGTTTCGCGTTGCTATAGAAGGCGATACAGCCCATTCAATGCCACTCGAACC
CGTGGCTGGAAGCCCTGTACTTGATCCTTTTGCCTCGCCTTCATCTCCGTTCGATCAGCCGGTGTCATCT
ATACCTGCAGATTTGGACGATCCACTCGCCGAATTTGGGAGTGGTTTGAGTTCAGGTGGCGGACTCTTGC
CCGATAGCGATTTGGCATTAAATGAGACAGATCCTCTGGCAGCGCTGGATAAAGCCGCAGCTGATCCGTT
TACTGCGTCGTCTGATCCGTTTGGTATTTCGGAAACCAACGACTTCGGCACAGAGAGTTTTCCATATGGC
CAGAACACCTACAGCGACAATAGTGACCCCCTCAGCGGTTCGTTTGATGCACCCAAAAGCAGTGGAGCCG
GCCTAATACCCGAAGATTGGGAAGACGACCTTCTCGGGGCAGAGCCTTTGCCCACGTTCGACGAGCCTCC
CAAGCCGGCGGCGCCTCCTTTAGTTACCGCCGCTGACGAGCTGGTTGCAAAGCGGCCCAACCCGAGACCA
ACCCCCAGGTCGCGGCCCGCTGAAAACAATGCGCGTCGTGATTTGTCGCAGCCCAACCGTGTTATACGCA
AAGCTTCGCGTCCCGCGACAACAGAAAAGCGCACTCCGCTGGATCGTTCATCCGCAAATGACACTGTCGA
GCAAGCTGCTGTTCCCAAGAGCAAGCCCAGCCCAAGGCACGCGAGCACATCCGAAGTTGCAATTAACTCA
GCATTGTTTGAGTCAATGGGGCTGGATGTCAGCCAGCTGTCGCAGGAAGAGCAGCAGGAGGTAGCTTGCG
CAGTTGGTGAACTCATGCCAGTAGTCGTAGAGGGGATGATGCGGGTGTTGCGTTCACGTGCGAGTATCAA
AAACGAATTCCGCATGAGCGTTACTACCATGCAACCGATAGAAAACAACCCGCTAAAGTTTTCCGCCGAC
AAAGGCGAGGCACTCGACATTATGTTTGTACGAAAAAGCAAGGCTTACAAGGCTCCGGTTGCCGCTTTTT
CCGAAGGTTTCGATGCTATTGCCGAGCACCAGGTTGCCATCATCGCTGGCATACGTGCTGCTTTCACAAA
AATGGTGGAACATTTTGACCCTGCGGCTTTAGAGCAGCAATTCGACAAGCAAAACAAAGGCGTGAATATT
CCAGGAATGCAGAAATCTCGCTACTGGAACAGCTACACGGCCTATTTTCAAGGGTTTATGGATAACATGG
AACAGTCCTTTCAAAACTTGTTTGGGGACGAGTTTGTACGCGCATACGAAGATCAGTTATTTAAGCTGAT
GACAGCGAGAAATATATCCGAAAAGTAA