SecReT6
Protein ID: 254785757
SecReT6 ID359
T6SS typei5
Gene symbol-
Locus tagTERTU_1661
StrainTeredinibacter turnerae T7901
Repliconchromosome [GenBank: NC_012997] [Browse all T6SS(s) in this replicon]
Location [Strand]1714351..1714839 [+]
Producttype VI secretion lipoprotein
NoteTssJ
UniProt IDC5BU08
KEGG IDttu:TERTU_1661
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 4.50E-33, Aligned region: 15..158
Protein Sequence: 162 a.a.     [Download]
>gi|254785757|ref|YP_003073186.1| type VI secretion lipoprotein [Teredinibacter turnerae T7901]
MKYCLKVCLLVAGLVLLSACDSMNNKVGGVLNLDTDLKLVVIAAEDVNPDEGGHPSPVFVRLYELKDTAT
FMKSDFLSIYERDTEVLGNELVARQELKRLAPGDSREERFVLNPETQYVALFAEFFDYKDARYKVMFAVT
TNNIVRNRMEVRLTKNNIYLEK
 
Nucleotide Sequence: 489 bp     [Download]
>gi|254784273|ref|NC_012997.1|:1714351-1714839 Teredinibacter turnerae T7901 chromosome, complete genome
ATGAAATACTGTTTGAAGGTCTGTCTGCTGGTCGCGGGCCTGGTTTTGCTATCGGCTTGCGATTCGATGA
ACAACAAAGTAGGTGGCGTATTAAATCTGGATACCGACCTTAAGCTGGTTGTAATTGCCGCCGAGGATGT
CAACCCCGATGAAGGCGGCCATCCTTCTCCTGTATTTGTTCGTCTTTATGAATTAAAAGACACGGCAACA
TTTATGAAGTCGGATTTTCTGTCGATCTACGAGCGCGATACTGAAGTATTGGGAAATGAGCTGGTTGCGC
GTCAGGAACTAAAACGTCTTGCTCCAGGAGACAGCCGGGAAGAACGTTTTGTTCTGAATCCGGAAACACA
ATATGTCGCCCTGTTTGCCGAATTTTTCGATTACAAAGACGCACGCTATAAAGTTATGTTTGCGGTAACA
ACAAATAATATAGTCCGCAACCGCATGGAAGTAAGACTGACTAAAAATAATATCTATTTGGAAAAATAA