SecReT6
Protein ID: 254785758
SecReT6 ID359
T6SS typei5
Gene symbol-
Locus tagTERTU_1662
StrainTeredinibacter turnerae T7901
Repliconchromosome [GenBank: NC_012997] [Browse all T6SS(s) in this replicon]
Location [Strand]1714855..1716189 [+]
Producttype VI secretion protein
NoteTssK
UniProt IDC5BU09
KEGG IDttu:TERTU_1662
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 3.50E-153, Aligned region: 19..443
Protein Sequence: 444 a.a.     [Download]
>gi|254785758|ref|YP_003073187.1| type VI secretion protein [Teredinibacter turnerae T7901]
MSLESKVVWKEGMFLNPQHFQQQERYLERYVHERCAAAAEYEWGMQLFDIDQQLLKLGKISVTKAKGIFP
DGTPFNAPDVDDVPPVLDVPENTLNARVYLSVPLRRPGAVEVQAEDGLQGLARFLSCEHEVRDVTKEGGD
AHKLSLGKLRLKLLLDSDDRSGYACIGVLKISEIRNDREIVLDDKHILSCLDCRASSKLTGFLTEVVGLL
TQRAQAIAGRLADTARGGTAEVADFMMLQFLNRMEPFMKHLSQLQGVHPLQLYQHIIQLAGEISTFASPT
KRAAEYPPYLHHELQSSFLPIMNSLRASLSMVYEQTAVSLPLVEKKYGIRVSEINDRTLISTAVYVLAVR
ADISEEAVRARIPAQIKIGPVERIRQLVNAAMPGIQIKPLPVAPRQIPFRAGYTYFQLEKQTPLWRELAS
SGGFALHIGGEFPGIEMEFWAIRQ
 
Nucleotide Sequence: 1335 bp     [Download]
>gi|254784273|ref|NC_012997.1|:1714855-1716189 Teredinibacter turnerae T7901 chromosome, complete genome
ATGTCACTAGAGAGTAAAGTTGTCTGGAAAGAGGGGATGTTTCTTAATCCTCAGCATTTTCAGCAGCAGG
AGCGGTACCTGGAGCGATATGTTCACGAGCGGTGCGCCGCCGCTGCGGAGTATGAGTGGGGTATGCAGCT
CTTCGACATAGACCAGCAGTTACTTAAACTGGGGAAAATATCTGTCACTAAGGCCAAGGGTATATTTCCT
GATGGAACGCCGTTCAATGCTCCAGATGTAGATGACGTTCCGCCGGTGCTGGATGTACCGGAGAACACGC
TTAATGCGCGCGTTTACCTCTCGGTTCCGCTGCGCAGGCCCGGTGCGGTAGAGGTGCAAGCAGAAGATGG
GTTGCAAGGTCTTGCCCGCTTTTTAAGCTGCGAGCACGAAGTCCGCGATGTAACGAAAGAAGGCGGAGAT
GCACACAAACTAAGCCTAGGCAAATTGCGGCTGAAGTTGTTGTTGGATTCAGATGATCGCAGCGGCTATG
CATGTATTGGCGTACTTAAAATTTCCGAGATCCGTAACGATCGCGAGATAGTTCTCGATGACAAGCATAT
ATTGAGCTGTCTTGATTGCCGTGCCTCGTCTAAATTAACCGGTTTTTTAACGGAGGTTGTTGGGTTGCTA
ACCCAGCGGGCTCAAGCGATCGCCGGGCGACTTGCCGATACCGCGCGGGGTGGTACTGCAGAAGTTGCTG
ACTTTATGATGTTACAGTTTTTAAACCGGATGGAGCCGTTCATGAAGCACCTGTCCCAGTTACAGGGTGT
TCATCCCCTTCAGCTCTATCAGCACATCATTCAATTGGCCGGTGAAATTAGTACGTTTGCGAGCCCGACG
AAACGCGCCGCCGAATACCCACCTTATTTACATCACGAGTTGCAGTCATCGTTTTTGCCAATAATGAACT
CGTTGCGTGCCAGTTTATCGATGGTGTATGAGCAAACTGCAGTTTCATTGCCCCTGGTGGAAAAAAAGTA
CGGTATCCGTGTTTCTGAAATTAATGATCGCACTCTAATAAGCACTGCTGTTTATGTATTGGCGGTGAGG
GCCGATATCTCCGAGGAAGCCGTGCGCGCCCGCATTCCTGCGCAAATTAAGATCGGACCAGTGGAGCGAA
TCCGACAGCTGGTGAATGCGGCAATGCCCGGTATTCAGATAAAGCCGCTTCCTGTGGCTCCTCGCCAAAT
TCCTTTCCGCGCGGGTTATACCTATTTTCAATTAGAAAAACAGACACCACTATGGCGGGAATTGGCGTCC
TCGGGCGGATTTGCACTGCATATAGGTGGTGAATTCCCTGGAATAGAGATGGAATTCTGGGCCATTAGAC
AATAA