SecReT6
Protein ID: 255037325
SecReT6 ID911
T6SS typeiii
Gene symbol-
Locus tagDfer_3574
StrainDyadobacter fermentans DSM 18053
Repliconchromosome [GenBank: NC_013037] [Browse all T6SS(s) in this replicon]
Location [Strand]4367450..4368613 [+]
Producthypothetical protein
NoteTssK
UniProt IDC6VU13
KEGG IDdfe:Dfer_3574
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.10E-05, Aligned region: 59..124
DUF876 [PF05936], Evalue: 1.10E-05, Aligned region: 178..214
Protein Sequence: 387 a.a.     [Download]
>gi|255037325|ref|YP_003087946.1| hypothetical protein Dfer_3574 [Dyadobacter fermentans DSM 18053]
MADIRRMAVNWVDGMKISRQHFLETDHYHLDQVRRAGAALLSPMSYGLLLPKDGIDPLEVQVLGDAGNQI
RVKVNRCQAITPDGSLLDIEENDDLKLDTSLAGILEQYRLPMTQNIEIYLVISIGMFERQPAGTPAESEM
PVRHPYTLPLYRVSLVPSELINIEQWGGPALIVGKLAYNNGEIRVLHDFVPASRAVRSHKNLREWHSRWS
GYLNDIEMYSFRILQKIKLKSQKSTLSDSVQMMVERLVGTMTMVNISFQRLAPWEPPVQMVTSMIQTAQA
VRTSLECLTDREKEELLAYLAEWADESPGSIEKQLLGVVQVAYNHNDILPCLRIIDGFYTMWTALFLKLS
QLEFIGKRKGQQVFIVESPVHEPPVQPEKAKSRWSPL
 
Nucleotide Sequence: 1164 bp     [Download]
>gi|255033817|ref|NC_013037.1|:4367450-4368613 Dyadobacter fermentans DSM 18053 chromosome, complete genome
ATGGCAGATATCCGTCGCATGGCCGTCAACTGGGTCGACGGGATGAAAATCTCGCGGCAACATTTCCTGG
AAACCGACCACTACCACCTCGATCAGGTCCGGCGCGCCGGGGCCGCATTGCTCTCCCCGATGAGCTACGG
CCTGCTGCTTCCGAAAGACGGCATTGATCCCCTGGAAGTGCAGGTGTTAGGCGATGCCGGAAACCAGATC
CGGGTGAAAGTGAACCGCTGCCAGGCCATTACGCCTGACGGCAGCCTGCTGGACATCGAAGAAAACGACG
ACCTGAAACTCGACACATCGCTGGCCGGCATATTAGAACAATACCGGCTCCCGATGACCCAGAACATTGA
AATATACCTGGTCATCAGCATTGGGATGTTCGAAAGACAGCCCGCCGGAACGCCCGCCGAATCGGAAATG
CCCGTGCGGCATCCGTACACGCTCCCGCTTTACCGCGTGAGCCTGGTGCCGTCGGAGCTAATCAATATAG
AACAATGGGGCGGTCCGGCCCTGATCGTCGGTAAGCTCGCATATAATAATGGCGAGATCCGCGTACTGCA
CGATTTCGTACCGGCAAGCCGCGCCGTGCGCAGCCACAAAAACCTGCGCGAATGGCACAGCCGGTGGAGC
GGCTATCTGAACGACATTGAAATGTATTCGTTCCGGATCTTGCAAAAGATCAAGTTGAAGAGCCAGAAAA
GCACATTATCCGACAGCGTGCAAATGATGGTAGAGCGGCTGGTGGGCACAATGACGATGGTCAATATCAG
CTTCCAGCGGCTGGCCCCCTGGGAACCGCCGGTGCAGATGGTGACCTCCATGATCCAGACCGCCCAGGCC
GTCCGCACCTCGCTGGAATGCCTTACCGACCGGGAAAAGGAAGAATTACTGGCCTATCTGGCCGAATGGG
CCGACGAGTCGCCGGGGAGCATTGAAAAGCAGCTGCTGGGCGTGGTGCAGGTGGCATACAATCACAACGA
CATTCTGCCCTGCCTGCGGATCATCGATGGCTTTTATACCATGTGGACGGCCCTTTTCCTGAAACTAAGC
CAGCTTGAATTCATCGGCAAACGGAAAGGACAGCAAGTTTTTATCGTCGAAAGTCCTGTACACGAGCCTC
CTGTGCAGCCCGAAAAGGCCAAATCGAGGTGGAGCCCTTTGTAA