SecReT6
Protein ID: 255037336
SecReT6 ID911
T6SS typeiii
Gene symbol-
Locus tagDfer_3585
StrainDyadobacter fermentans DSM 18053
Repliconchromosome [GenBank: NC_013037] [Browse all T6SS(s) in this replicon]
Location [Strand]4379176..4379625 [+]
Producthypothetical protein
NoteTssB
UniProt IDC6VU24
KEGG IDdfe:Dfer_3585
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 149 a.a.     [Download]
>gi|255037336|ref|YP_003087957.1| hypothetical protein Dfer_3585 [Dyadobacter fermentans DSM 18053]
MFNYGIGGNERKIDQSSEGIADIPQNRTLFATQLTGDPSPRPEMVYDLKTTEEVFAHYQPEAEVEFITSD
GSFINENLRFRNLGDFGKKGIIAQSAFLQDLDARNEAYQQVVRHLKVNKILKAALEKPEAKAALLGVFQT
LINELEEAG
 
Nucleotide Sequence: 450 bp     [Download]
>gi|255033817|ref|NC_013037.1|:4379176-4379625 Dyadobacter fermentans DSM 18053 chromosome, complete genome
ATGTTCAACTACGGAATAGGCGGTAACGAACGCAAGATTGACCAGTCCAGTGAAGGGATTGCTGATATTC
CCCAAAACCGCACCCTGTTCGCCACGCAGCTCACCGGCGACCCGTCGCCGCGGCCCGAAATGGTTTACGA
TCTCAAAACCACCGAAGAAGTTTTCGCGCATTACCAGCCCGAGGCCGAGGTCGAATTCATCACTTCCGAC
GGCAGCTTTATTAATGAAAACCTGCGGTTCAGAAACCTGGGTGATTTTGGCAAAAAAGGGATCATCGCGC
AAAGCGCATTCCTCCAAGACCTCGACGCCCGCAACGAAGCCTACCAACAGGTAGTGAGGCATCTCAAAGT
GAACAAAATCCTCAAAGCCGCATTAGAAAAACCCGAAGCTAAAGCCGCCCTCCTGGGCGTGTTCCAGACG
CTTATTAACGAGTTGGAGGAGGCGGGGTGA