SecReT6
Protein ID: 255037337
SecReT6 ID911
T6SS typeiii
Gene symbol-
Locus tagDfer_3586
StrainDyadobacter fermentans DSM 18053
Repliconchromosome [GenBank: NC_013037] [Browse all T6SS(s) in this replicon]
Location [Strand]4379843..4381210 [+]
Producthypothetical protein
NoteTssC
UniProt IDC6VU25
KEGG IDdfe:Dfer_3586
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.90E-13, Aligned region: 117..430
Phage_sheath_1 [PF04984], Evalue: 0.0057, Aligned region: 347..433
Protein Sequence: 455 a.a.     [Download]
>gi|255037337|ref|YP_003087958.1| hypothetical protein Dfer_3586 [Dyadobacter fermentans DSM 18053]
MADNTKTSQEATPALRERVAVPLETGLPQLAKYGSFDLVETIIEGAANINPEKKARKKIFLTEADKKKER
QQLKKRLELWSELLSSAESVPDMIEAGQKQADSAFELLKENLGKAVEQVRPLEQSYRSVAMFFKNTEQDK
VKNVTFLNAAPDQLQDLDVTTFIDAVGEELASKYDRLDLRENYSILNVPGYLGSGKVVDKWAKMAHKNKV
MLLTDFMHLDAPEDVMELFESANLTGGSAHLSNVMMTCNWLVGRAKHDDLGEEDDLYIPPSTALAGNVYK
TLMSQVAAGKKHGTLSEVDGVRFPLKKSEIADLEKMGLIPMVNEYSKVMAFSAKTLFNGDNVGLQTYSVV
RVFDYITKVLIDFLNRRAFENFDYNTKNDLKKQIIKFLDSVTGPGKLIEKFSVMRFEQDKNQKDKVYLDI
HMVPYFPAKNFMIALTGQKGDDLDAAAWAAEYAQQ
 
Nucleotide Sequence: 1368 bp     [Download]
>gi|255033817|ref|NC_013037.1|:4379843-4381210 Dyadobacter fermentans DSM 18053 chromosome, complete genome
ATGGCAGACAATACAAAAACATCCCAGGAAGCCACCCCGGCGCTTCGCGAACGCGTAGCGGTTCCGTTGG
AAACCGGCTTGCCGCAGCTGGCCAAATATGGCAGTTTCGACCTCGTAGAGACGATTATCGAGGGTGCGGC
GAACATTAATCCCGAAAAAAAGGCACGCAAGAAGATATTCCTCACCGAGGCCGACAAAAAGAAAGAGCGC
CAGCAACTGAAAAAGCGGCTGGAATTATGGTCGGAACTGCTGAGCAGCGCCGAAAGTGTGCCGGATATGA
TCGAAGCCGGCCAGAAACAGGCGGATTCGGCATTTGAACTGCTGAAAGAAAACTTGGGCAAGGCCGTAGA
GCAGGTCCGTCCGCTGGAACAATCGTACCGCTCGGTGGCGATGTTTTTCAAAAATACAGAGCAGGATAAG
GTTAAAAACGTCACTTTCCTGAATGCCGCGCCGGACCAGTTGCAGGACCTGGATGTGACCACGTTCATCG
ACGCCGTGGGCGAAGAGCTGGCTTCGAAATACGACCGCCTCGATTTGCGGGAAAATTATTCGATCCTGAA
TGTACCCGGCTATCTCGGTTCGGGAAAAGTAGTGGATAAATGGGCGAAAATGGCCCATAAAAACAAGGTA
ATGCTGCTTACCGACTTCATGCATTTGGATGCGCCGGAGGACGTGATGGAACTCTTCGAATCCGCTAACC
TGACCGGCGGCTCGGCGCATTTATCGAATGTGATGATGACCTGCAACTGGCTCGTAGGCCGTGCGAAACA
CGACGACCTGGGCGAAGAGGACGATCTCTACATTCCCCCATCGACTGCCCTGGCCGGCAATGTTTACAAA
ACCCTGATGTCGCAGGTGGCGGCGGGTAAGAAACACGGCACGCTGAGCGAAGTGGATGGCGTACGCTTCC
CGCTCAAAAAATCGGAAATCGCCGATCTGGAAAAAATGGGGCTGATCCCGATGGTGAATGAATACAGCAA
GGTTATGGCTTTCTCTGCCAAAACGCTGTTCAATGGCGATAATGTCGGCTTGCAAACCTACTCAGTAGTC
CGCGTTTTCGATTACATCACGAAGGTGCTTATCGATTTCCTGAACCGACGCGCGTTCGAAAACTTCGACT
ACAACACCAAAAACGACCTGAAAAAACAGATCATCAAGTTTCTCGACAGCGTAACCGGCCCGGGCAAACT
GATCGAAAAATTCAGTGTGATGCGTTTTGAGCAGGACAAAAACCAGAAAGACAAAGTGTATCTCGACATC
CACATGGTACCCTATTTCCCAGCCAAAAACTTCATGATCGCCCTCACCGGCCAGAAAGGAGACGATCTGG
ACGCGGCAGCCTGGGCGGCGGAGTATGCGCAGCAGTAG